Antibodies

View as table Download

Rabbit Polyclonal Anti-AIP Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: FHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEI

Rabbit Polyclonal Anti-AIP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIP antibody: synthetic peptide directed towards the middle region of human AIP. Synthetic peptide located within the following region: NAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFS

Goat Polyclonal Antibody against AIP

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EARIRQKDEEDKAR, from the C Terminus of the protein sequence according to NP_003968.1.

Rabbit Polyclonal antibody to ARA9 (aryl hydrocarbon receptor interacting protein)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 330 of ARA9 (Uniprot ID#O00170)

Rabbit Polyclonal Anti-AIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: VAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIF

Mouse Monoclonal Antibody against ARA9 (35-2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal Anti-AIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: PLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPL

Rabbit Polyclonal Anti-Aip Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Aip antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VAKSLRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIF

Rabbit Polyclonal Anti-AIP Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AIP antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: REDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGK

Carrier-free (BSA/glycerol-free) AIP mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AIP Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse AIP

AIP Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human AIP (NP_003968.3).
Modifications Unmodified

AIP Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human AIP (NP_003968.3).
Modifications Unmodified

AIP (ARA9) mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AIP (ARA9) mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated