Caldesmon (CALD1) rabbit monoclonal antibody, clone EP19, Supernatant
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Caldesmon (CALD1) rabbit monoclonal antibody, clone EP19, Supernatant
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Rabbit polyclonal Bcl-6 (Ser333) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bcl-6 around the phosphorylation site of serine 333 (P-Q-SP-P-Q). |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-BCL6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BCL6 antibody is: synthetic peptide directed towards the C-terminal region of Human BCL6. Synthetic peptide located within the following region: IHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP |
Calponin (CNN1) rabbit monoclonal antibody, clone EP798Y, Supernatant
Applications | IF, IHC, WB |
Reactivities | Human |
CD14 rabbit monoclonal antibody, clone EPR3653, Supernatant
Applications | IF, IHC, WB |
Reactivities | Human |
bcl 6 (BCL6) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 675-704 amino acids from the C-terminal region of human BCL6 |
Rabbit Polyclonal BCL6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BCL6 antibody was raised against an 18 amino acid synthetic peptide near the center of human BCL6. |
Mouse monoclonal BCL6 Antibody (C-term) (Ascites)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Bcl-6 (Ab-333) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Bcl-6 around the phosphorylation site of serine 333 (P-Q-SP-P-Q). |
Carrier-free (BSA/glycerol-free) BCL6 mouse monoclonal antibody, clone OTI13H4 (formerly 13H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BCL6 mouse monoclonal antibody, clone OTI11D8 (formerly 11D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BCL6 mouse monoclonal antibody, clone OTI20A3 (formerly 20A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BCL6 mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BCL6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BCL6 |
BCL6 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human BCL6 (NP_001697.2). |
Modifications | Unmodified |
Bcl6 Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human BCL6. AA range:271-320 |
BCL6 mouse monoclonal antibody, clone OTI13H4 (formerly 13H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
BCL6 mouse monoclonal antibody, clone OTI13H4 (formerly 13H4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
BCL6 mouse monoclonal antibody, clone OTI13H4 (formerly 13H4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BCL6 mouse monoclonal antibody, clone OTI13H4 (formerly 13H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
BCL6 mouse monoclonal antibody, clone OTI11D8 (formerly 11D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
BCL6 mouse monoclonal antibody, clone OTI11D8 (formerly 11D8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
BCL6 mouse monoclonal antibody, clone OTI11D8 (formerly 11D8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BCL6 mouse monoclonal antibody, clone OTI11D8 (formerly 11D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
BCL6 mouse monoclonal antibody, clone OTI20A3 (formerly 20A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
BCL6 mouse monoclonal antibody,clone 20A3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
BCL6 mouse monoclonal antibody,clone 20A3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
BCL6 mouse monoclonal antibody, clone OTI20A3 (formerly 20A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Purified BCL6 mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified BCL6 mouse monoclonal antibody, clone OTI6C7 (formerly 6C7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Purified BCL6 mouse monoclonal antibody, clone OTI6C7 (formerly 6C7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Purified BCL6 mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".