Rabbit Polyclonal Anti-NES Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NES antibody: synthetic peptide directed towards the middle region of human NES. Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA |
Mouse Monoclonal Nestin Antibody (10C2)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal Nestin Antibody (S1409)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Nestin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1389-1416 amino acids from human Nestin. |
Nes chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | Three synthetic peptides KLH conjugated corresponding to different regions of the Mouse Nestin gene product (NP_057910), but are shared with the Rat (NM_012987) protein sequence. Production: After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 0.3 mg/ml. Finally, equal volumes of each of the three affinity-purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
Rabbit polyclonal anti-Nestin antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1484-1500 of human Nestin protein. |
Rabbit anti-NES polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human Nestin |
Mouse Anti-Human Nestin Purified (25 ug)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Nestin Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1392-1621 of human Nestin (NP_006608.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
