Rabbit Polyclonal HIF-2 alpha Antibody
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Rabbit Polyclonal HIF-2 alpha Antibody
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Mouse Monoclonal Antibody against HIF-2 alpha (ep190b)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Epas1 (202-240) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at N-terminus of Rat HIF-2-alpha (202-240) |
HIF 2 alpha (EPAS1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 127-154 amino acids from the N-terminal region of Human HIF2A |
Mouse monoclonal HIF2 alpha Antibody
Applications | IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-EPAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1/HIF2α Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 588-870 of human EPAS1/HIF2α (NP_001421.2). |
Modifications | Unmodified |
EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
EPAS1 mouse monoclonal antibody,clone 2G5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
EPAS1 mouse monoclonal antibody,clone 2G5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EPAS1 mouse monoclonal antibody,clone OTI6G3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
EPAS1 mouse monoclonal antibody,clone OTI6G3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |