Antibodies

View as table Download

Rabbit Polyclonal Antibody against XCT

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50).

Rabbit Polyclonal xCT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus of the mouse xCT protein (between residues 1-50). [UniProt# Q9WTR6]

Goat Polyclonal Antibody against SLC7A11

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KGQTQNFKDAFSGRD, from the internal region of the protein sequence according to NP_055146.1.

Rabbit Polyclonal Anti-SLC7A11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A11 Antibody: synthetic peptide directed towards the middle region of human SLC7A11. Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK

Rabbit Polyclonal Anti-SLC7A11 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC7A11

SLC7A11/xCT Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A11/xCT (NP_055146.1).
Modifications Unmodified

SLC7A11/xCT Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A11/xCT (NP_055146.1).
Modifications Unmodified

xCT Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated