Antibodies

View as table Download

IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700023

Rabbit Polyclonal Anti-IRF3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IRF3

Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L).
Modifications Phospho-specific

Mouse Monoclonal RelA/NFkB p65 Antibody (112A1021)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932
Modifications Phospho-specific

Rabbit Polyclonal ZBP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZBP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human ZBP1.

Anti-DDX58 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 909-925 amino acids of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58

Rabbit polyclonal IRF-3 (Ser386) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 386 (A-S-SP-L-E).
Modifications Phospho-specific

TMEM173 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4E12

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700184

Rabbit Polyclonal Caspase-1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-1 antibody was raised against a 15 amino acid peptide from near the middle of human Caspase-1.

Rabbit Polyclonal Anti-NFKB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NFKB1

Rabbit Polyclonal Anti-NFKBIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NFKBIB

Rabbit Polyclonal MPYS Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MPYS antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MPYS.

Rabbit polyclonal IkB-a (Ab-32/36) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human I?B-a around the phosphorylation site of Serine 32/36.

Rabbit polyclonal NFkB p65 phospho S536 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding S536 of human p65 (RelA) protein.

Rabbit Polyclonal NF- kappaB p65 (Ser536) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p65 around the phosphorylation site of Serine 536
Modifications Phospho-specific

Rabbit Polyclonal NF-kappaB p65 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF-kappaB p65

TMEM173 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4A7

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700184

TMEM173 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1G5

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700184

TMEM173 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A7

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700184

TMEM173 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2C9

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700185

Rabbit polyclonal IKK-gamma (Ser85) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R).
Modifications Phospho-specific

Rabbit polyclonal IKK-gamma (Ab-85) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R)

Rabbit polyclonal anti-OR10G6 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10G6.

Rabbit polyclonal IKK-alpha (Ser176)/IKK-beta (Phospho-Ser177) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IKK-a around the phosphorylation site of serine 176/177 (Q-G-SP-L-C).
Modifications Phospho-specific

Rabbit polyclonal NF-kB p65 (Ab-311) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of serine 311 (F-K-SP-I-M).

Rabbit polyclonal IkB-a (Tyr305) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human I?B-a around the phosphorylation site of tyrosine 305 (L-P-YP-D-D).
Modifications Phospho-specific

Rabbit polyclonal NF-kB p105/p50 (Ser893) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NF-?B p105/p50 around the phosphorylation site of serine 893.
Modifications Phospho-specific

Rabbit polyclonal anti-CSRL1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSRL1.

Anti-NFKBIA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-317 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha

Rabbit polyclonal ASC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ASC.

Rabbit Polyclonal Anti-MAVS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ

Goat Polyclonal Antibody against ASC / TMS1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RESQSYLVEDLERS, from the C Terminus of the protein sequence according to NP_037390.2; NP_660183.1; NP_660184.1.

Rabbit polyclonal anti-IKK-gamma antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IKK-?.

Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P).
Modifications Phospho-specific

Rabbit polyclonal NF-kB p65 (Ser281) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NF-kB p65 around the phosphorylation site of serine 281 (E-L-SP-E-P)
Modifications Phospho-specific

Rabbit polyclonal Caspase 1 (Cleaved-Asp210) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 1.

Rabbit polyclonal Caspase 1 (p10, Cleaved-Ala317) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CASP1.

Rabbit polyclonal anti-RPC4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC4.

Rabbit polyclonal anti-POLR3H (RPC8) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC8.

Rabbit Polyclonal IKK-alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-alpha

Rabbit Polyclonal IKK-alpha/beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-alpha/beta

Rabbit Polyclonal IKK-alpha/beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-alpha/beta

Rabbit Polyclonal IKK- alpha (Ser176) /IKK- beta (Ser177) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- alpha /IKK- beta around the phosphorylation site of Serine 177
Modifications Phospho-specific

Rabbit Polyclonal IKK- alpha (Thr23) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- alpha around the phosphorylation site of Threonine 23
Modifications Phospho-specific

Rabbit Polyclonal IKK- alpha/ beta (Ser180/181) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- alpha/ beta around the phosphorylation site of Serine 180/181
Modifications Phospho-specific

Rabbit Polyclonal IKK-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-beta

Rabbit Polyclonal IKK- beta (Tyr188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 188
Modifications Phospho-specific

Rabbit Polyclonal IKK- beta (Tyr199) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 199
Modifications Phospho-specific