Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3C2-4
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3G11-14
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 4A5-19
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5F4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5G12-21
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6F5-23
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6H8-22
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8E8-2
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8F6-6
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 9G5-20
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 12G4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 15C4-8
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 16F12-11
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human: Ser246, Mouse: Ser246 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M). |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
ERBB2 Capture mouse monoclonal antibody, Luminex validated, clone OTI12G4
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700215 |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal MAP3K7 (Thr187) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MAP3K7 around the phosphorylation site of Threonine 187 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Src (Tyr418) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 418 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Src (Tyr529) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 529 |
| Modifications | Phospho-specific |
USD 379.00
In Stock
Active filters
Category
-
Antibodies
- Primary Antibodies
Conjugates
- Unconjugated
Pathways
- Adherens junction
Availabilities
- In Stock
Filter by
Target Symbol
- ERBB2 (79)
- EGFR (73)
- CTNNB1 (51)
- SNAI2 (29)
- CDH1 (24)
- MET (24)
- MAPK1 (20)
- FGFR1 (18)
- IGF1R (12)
- CTNND1 (11)
- PTPN1 (11)
- SRC (11)
- SHC1 (10)
- SNAI1 (10)
- MAPK3 (9)
- SSX2IP (9)
- WASL (9)
- BAIAP2 (8)
- IQGAP1 (8)
- ACTB (7)
- MAP3K7 (7)
- SMAD2 (7)
- ACTN1 (6)
- INSR (6)
- NECTIN1 (6)
- PTPN6 (6)
- SMAD3 (6)
- TGFBR2 (6)
- FYN (4)
- RAC1 (4)
- ACTN3 (3)
- ACVR1C (3)
- PTPRJ (3)
- RHOA (3)
- ACTG1 (2)
- ACTN2 (2)
- ACVR1B (2)
- CREBBP (2)
- CSNK2A1 (2)
- CSNK2B (2)
- EP300 (2)
- LEF1 (2)
- PTPRM (2)
- TGFBR1 (2)
- VCL (2)
- WASF3 (2)
- ACTN4 (1)
- CDC42 (1)
- CTNNA1 (1)
- FARP2 (1)
- MLLT4 (1)
- NECTIN3 (1)
- NECTIN4 (1)
- NLK (1)
- PARD3 (1)
- RAC2 (1)
- SMAD4 (1)
- TCF7 (1)
- TCF7L1 (1)
- TCF7L2 (1)
- TJP1 (1)
- WASF1 (1)
- WASF2 (1)
- YES1 (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (520)
- Protein Kinase (280)
- Transmembrane (273)
- ES Cell Differentiation/IPS (205)
- Transcription Factors (102)
- Stem cell relevant signaling - JAK/STAT signaling pathway (97)
- Cancer stem cells (86)
- Adult stem cells (75)
- Secreted Protein (73)
- Phosphatase (22)
- Embryonic stem cells (13)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (13)
- Stem cell - Pluripotency (6)