Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-KEAP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human kelch-like ECH-associated protein 1 |
Rabbit Polyclonal anti-Elongin C Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant full-length |
Rabbit Polyclonal KEAP1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit Polyclonal anti-TRIM32 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE |
Goat Polyclonal Antibody against VHL
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSLVKPENYRRLD, from the internal region of the protein sequence according to NP_000542.1; NP_937799.1. |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal BRCA1 (Ser1457) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1457 (L-T-SP-Q-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal BRCA1 (Ab-1423) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit Polyclonal BRCA1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 |
Rabbit Polyclonal BRCA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 |
Rabbit Polyclonal CBL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL |
Rabbit Polyclonal CBL (Tyr674) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL around the phosphorylation site of Tyrosine 674 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 around the phosphorylation site of Serine 166 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-BRCA1 (Ser1423) Antibody (Phospho-specific)
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 around the phosphorylation site of Serine 1423 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-BRCA1 (Ser1524) Antibody (Phospho-specific)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 around the phosphorylation site of Serine 1524 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VHL Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VHL |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Carrier-free (BSA/glycerol-free) KEAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BRCA1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Families
- Transcription Factors
Pathways
- Ubiquitin mediated proteolysis
Availabilities
- In Stock