Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II). |
Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237) |
Anti-ADH5 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Mouse monoclonal ALDH2 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
Rabbit polyclonal antibody to PGAM2 (phosphoglycerate mutase 2 (muscle))
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of PGAM2 (Uniprot ID#P15259) |
LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALDH2 mouse monoclonal antibody, clone OTI4H2 (formerly 4H2)
Applications | FC, IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
ALDH1A3 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALDH1A3 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |