Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-HSP60 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSP60 Antibody: A synthesized peptide derived from human HSP60 |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG |
Rabbit Polyclonal Antibody against CNOT4 (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CNOT4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-84 amino acids from the N-terminal region of human CNOT4. |
Goat Anti-C1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKNASKVANKGKSKS, from the C Terminus of the protein sequence according to NP_775269.1. |
Rabbit Polyclonal CNOT4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CNOT4 antibody was raised against a 19 amino acid peptide near the amino terminus of the human CNOT4. |
Rabbit polyclonal Hsp60 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human Hsp60 produced through recombinant DNA methods in E.coli |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR |
Rabbit Polyclonal Anti-C1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1D antibody: synthetic peptide directed towards the N terminal of human C1D. Synthetic peptide located within the following region: AGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLE |
Rabbit Polyclonal Anti-C1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1D antibody: synthetic peptide directed towards the middle region of human C1D. Synthetic peptide located within the following region: LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR |
Anti-HSPD1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ENO1 |
Active filters
Category
- Antibodies
Reactivities
- Human
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- RNA degradation