Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP |
Rabbit Polyclonal Anti-SUFU Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against Casein Kinase 1, delta
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1. |
Goat Polyclonal Antibody against WNT4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2. |
Goat Polyclonal Antibody against SMO (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1. |
Rabbit polyclonal CK-1a (Tyr294) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CK-1a around the phosphorylation site of tyrosine 294 (Y-D-YP-T-F). |
| Modifications | Phospho-specific |
GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta. |
Anti-Human BMP-7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHO cells derived Recombinant Human BMP-7 |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-WNT10B Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-RAB23 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rab23 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DPEQTHSSSNKIGVFNASVRSHLGQNSSSLNGGDVINLRPNKQRTKRTRN |
Rabbit Polyclonal Anti-RAB23 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB23 antibody: synthetic peptide directed towards the N terminal of human RAB23. Synthetic peptide located within the following region: TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA |
Rabbit Polyclonal Anti-Patched Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched |
Rabbit Polyclonal Anti-KAPC A/B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KAPC A/B Antibody: A synthesized peptide derived from human KAPC A/B |
Rabbit polyclonal antibody to Dhh (desert hedgehog homolog (Drosophila))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 135 and 396 of Dhh (Uniprot ID#O43323) |
Rabbit polyclonal anti-KAPCG antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAPCG. |
Rabbit polyclonal anti-BMP8B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BMP8B. |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
Rabbit polyclonal anti-KAPC A/B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAPC A/B. |
Rabbit polyclonal anti-KAPCB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAPCB. |
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit polyclonal anti-CKI-?1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CKI-?1. |
Anti-WNT5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit polyclonal FBXW11 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FBXW11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-196 amino acids from the Central region of human FBXW11. |
Rabbit polyclonal Bi-Phospho-GSK3B(S21/29) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GSK3B Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S21/29 of human GSK3B. |
| Modifications | Phospho-specific |
Rabbit polyclonal WNT10B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B. |
Rabbit Polyclonal GSK3 beta (Ser9) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GSK3 beta around the phosphorylation site of Serine 9 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal WNT4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-SMO antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SMO. |
Active filters
Category
- Antibodies
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Hedgehog signaling pathway
Filter by
Target Symbol
- GSK3B (15)
- PRKACA (7)
- WNT1 (6)
- WNT3A (6)
- CSNK1A1 (5)
- WNT4 (5)
- BMP6 (4)
- FBXW11 (4)
- PRKACB (4)
- SUFU (4)
- WNT10B (4)
- BMP2 (3)
- BMP5 (3)
- BMP7 (3)
- CSNK1D (3)
- DHH (3)
- PRKACG (3)
- PRKX (3)
- PTCH1 (3)
- RAB23 (3)
- SHH (3)
- SMO (3)
- WNT5A (3)
- BMP4 (2)
- BMP8B (2)
- CSNK1A1L (2)
- CSNK1G2 (2)
- GLI2 (2)
- GLI3 (2)
- LRP2 (2)
- STK36 (2)
- ZIC2 (2)
- BTRC (1)
- CSNK1E (1)
- CSNK1G1 (1)
- CSNK1G3 (1)
- GLI1 (1)
- IHH (1)
- PTCH2 (1)
- WNT3 (1)
- WNT7A (1)