Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
Rabbit Polyclonal Anti-GRHPR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRHPR antibody: synthetic peptide directed towards the N terminal of human GRHPR. Synthetic peptide located within the following region: EPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDH |
Rabbit Polyclonal Anti-MDH2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDH2 antibody: synthetic peptide directed towards the C terminal of human MDH2. Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK |
Goat Polyclonal Anti-MDH1 / MOR2 (aa211-223) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MDH1 / MOR2 (aa211-223) Antibody: Peptide with sequence C-PDVNHAKVKLQGK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |
Goat Polyclonal Anti-MDH1 / MOR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MDH1 / MOR2 Antibody: Peptide with sequence TNCLTASKSAPSIPK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |
Rabbit Polyclonal Anti-HAO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAO2 antibody: synthetic peptide directed towards the N terminal of human HAO2. Synthetic peptide located within the following region: DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW |
Rabbit Polyclonal Antibody against ACO2 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACO2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 294-325 amino acids from the Central region of human ACO2. |
Mouse Anti-Human MDH2 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HAO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAO1 antibody: synthetic peptide directed towards the C terminal of human HAO1. Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV |
Rabbit Polyclonal Anti-MDH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1. Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV |
Goat Anti-ACO1 / Aconitase 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QVDFNRRADSLQKNQ, from the internal region of the protein sequence according to NP_002188.1. |
Rabbit polyclonal MTHFD2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2. |
Rabbit Polyclonal Anti-MTHFD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD |
Rabbit polyclonal IREB1 / ACO1 (Ser711) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IREB1 around the phosphorylation site of serine 711 (Y-G-SP-R-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MTHFD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYV |
Rabbit Polyclonal Anti-PGP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGP antibody is: synthetic peptide directed towards the C-terminal region of PGP. Synthetic peptide located within the following region: TDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIA |
Goat Anti-MTHFD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RGDLNDCFIPCTPK, from the internal region of the protein sequence according to NP_005947.2. |
Goat Anti-Aconitase 2 / ACO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QHVDVSPTSQRLQ, from the internal region of the protein sequence according to NP_001089.1. |
Goat Anti-MTHFD1L (aa535-538) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DTNDRFLRKITIGQ, from the internal region of the protein sequence according to NP_056255.2. |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the middle region of human MTHFD2. Synthetic peptide located within the following region: VWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVT |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN |
Rabbit Polyclonal Anti-GLYCTK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the N terminal of human GLYCTK. Synthetic peptide located within the following region: IQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGA |
Rabbit Polyclonal Anti-GLYCTK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the middle region of human GLYCTK. Synthetic peptide located within the following region: KPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS |
Germany
Japan
United Kingdom
China
