Antibodies

Jump to Filters
View as table Download
Monoamine Oxidase B (MAOB) Goat Polyclonal Antibody
TA318153

USD 425.00

In Stock

Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%).
AMD1 Rabbit Polyclonal Antibody
TA323135

USD 345.00

In Stock

Anti-AMD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1
eNOS (NOS3) Rabbit Polyclonal Antibody
TA323615

USD 345.00

4 Weeks

Anti-NOS3 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.1175~1179 (T-Q-S-F-S) derived from Human eNOS.
NOS1 Rabbit Polyclonal Antibody
TA325737

USD 345.00

In Stock

Rabbit Polyclonal n-NOS (Ser852) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human n-NOS around the phosphorylation site of Serine 852
Modifications Phospho-specific
GLUD1 Rabbit Polyclonal Antibody
TA338163

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
ALDH7A1 Rabbit Polyclonal Antibody
TA344576

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA346079

USD 475.00

5 Days

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA346080

USD 475.00

5 Days

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI
GAMT Rabbit Polyclonal Antibody
TA346164

USD 475.00

5 Days

Rabbit Polyclonal Anti-GAMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the N terminal of human GAMT. Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM
iNOS (NOS2) Rabbit Polyclonal Antibody
TA347419

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-iNOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-iNOS Antibody: A synthesized peptide derived from human iNOS
NOS1 Rabbit Polyclonal Antibody
TA347878

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-nNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-nNOS Antibody: A synthesized peptide derived from human nNOS
iNOS (NOS2) Rabbit Polyclonal Antibody
TA347995

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-iNOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-iNOS Antibody: A synthesized peptide derived from human iNOS
eNOS (NOS3) Rabbit Polyclonal Antibody
TA348426

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Phospho-eNOS(Ser615) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-eNOS(Ser615) Antibody: A synthesized peptide derived from human eNOS around the phosphorylation site of Sersine 615
Modifications Phospho-specific
NOS1 Rabbit Polyclonal Antibody
TA348683

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Phospho-n-NOS (Ser852) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-n-NOS (Ser852) Antibody: A synthesized peptide derived from human n-NOS around the phosphorylation site of Serine 852
Modifications Phospho-specific
Aldehyde dehydrogenase 10 (ALDH3A2) Goat Polyclonal Antibody
TA348940

USD 429.00

5 Days

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.
ALDH2 Rabbit Polyclonal Antibody
TA302017

USD 450.00

2 Weeks

Rabbit Polyclonal Antibody against ALDH2 (N-term)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.
Creatine kinase B type (CKB) Rabbit Polyclonal Antibody
TA308722

USD 415.00

5 Days

Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277)
CKMT1B Rabbit Polyclonal Antibody
TA308867

USD 415.00

5 Days

Rabbit Polyclonal antibody to Creatine kinase 1B (creatine kinase, mitochondrial 1B)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 63 and 287 of Creatine kinase MT 1B (Uniprot ID#P12532)
P5CS (ALDH18A1) Goat Polyclonal Antibody
TA311248

USD 375.00

2 Weeks

Goat Anti-ALDH18A1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-SEHGSLKYLH, from the C Terminus of the protein sequence according to NP_002851.2; NP_001017423.1.
ALDH1B1 Rabbit Polyclonal Antibody
TA313443

USD 345.00

In Stock

Rabbit polyclonal anti-ALDH1B1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1.
CKMT2 Rabbit Polyclonal Antibody
TA313626

USD 345.00

4 Weeks

Rabbit polyclonal anti-CKMT2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKMT2.
eNOS (NOS3) Rabbit Polyclonal Antibody
TA314269

USD 345.00

In Stock

Rabbit polyclonal Enos (Ab-494) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Enos around the phosphorylation site of threonine 494 (K-K-TP-F-K).
Ornithine Carbamoyltransferase (OTC) Rabbit Polyclonal Antibody
TA324880

USD 450.00

5 Days

Rabbit polyclonal OTC Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This OTC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the Central region of human OTC.
NOS1 Rabbit Polyclonal Antibody
TA325736

USD 345.00

In Stock

Rabbit Polyclonal nNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human nNOS
iNOS (NOS2) Rabbit Polyclonal Antibody
TA325739

USD 345.00

4 Weeks

Rabbit Polyclonal iNOS (Tyr151) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human iNOS around the phosphorylation site of Tyrosine 151
Modifications Phospho-specific
eNOS (NOS3) Rabbit Polyclonal Antibody
TA325741

USD 345.00

In Stock

Rabbit Polyclonal eNOS (Ser1176) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human eNOS around the phosphorylation site of Serine 1176
Modifications Phospho-specific
eNOS (NOS3) Rabbit Polyclonal Antibody
TA325742

USD 345.00

In Stock

Rabbit Polyclonal eNOS (Thr494) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human eNOS around the phosphorylation site of Threonine 494
Modifications Phospho-specific
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA326119

USD 345.00

In Stock

Rabbit polyclonal ARG1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARG1.
P4HA3 Rabbit Polyclonal Antibody
TA334343

USD 375.00

5 Days

Rabbit Polyclonal Anti-P4HA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P4HA3 antibody is: synthetic peptide directed towards the N-terminal region of Human P4HA3. Synthetic peptide located within the following region: EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQD
P5CS (ALDH18A1) Rabbit Polyclonal Antibody
TA336073

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALDH18A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH18A1 Antibody: synthetic peptide directed towards the N terminal of human ALDH18A1. Synthetic peptide located within the following region: SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338396

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
ALDH1B1 Rabbit Polyclonal Antibody
TA350847

USD 345.00

In Stock

Rabbit Polyclonal Anti-ALDH1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALDH1B1
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA306639

USD 430.00

5 Days

Rabbit Polyclonal Aldh3A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2.
ALDH2 Goat Polyclonal Antibody
TA311134

USD 375.00

5 Days

Goat Anti-ALDH2 Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DETQFKKILGYIN, from the internal region of the protein sequence according to NP_000681.2.
ALDH9A1 Goat Polyclonal Antibody
TA311138

USD 375.00

5 Days

Goat Anti-ALDH9A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKEILDKFTEEVVKQ, from the internal region of the protein sequence according to NP_000687.3.
iNOS (NOS2) Rabbit Polyclonal Antibody
TA314267

USD 345.00

4 Weeks

Rabbit polyclonal Inos (Tyr151) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Inos around the phosphorylation site of tyrosine 151 (Q-Y-YP-G-S).
Modifications Phospho-specific
CKMT1B Rabbit Polyclonal Antibody
TA331807

USD 375.00

5 Days

Rabbit Polyclonal Anti-CKMT1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CKMT1B Antibody is: synthetic peptide directed towards the N-terminal region of Human CKMT1B. Synthetic peptide located within the following region: TVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGY
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA332354

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV
Monoamine Oxidase B (MAOB) Rabbit Polyclonal Antibody
TA332355

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA
Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody
TA335228

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG
eNOS (NOS3) Mouse Monoclonal Antibody [Clone ID: 6H2]
TA336799

USD 424.00

5 Days

Mouse Monoclonal eNOS Antibody (6H2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336799 is a replacement of AM06374SU-N.
GLUD1 Rabbit Polyclonal Antibody
TA338162

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
ALDH4A1 Rabbit Polyclonal Antibody
TA338212

USD 310.00

5 Days

Rabbit Polyclonal Anti-ALDH4A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH4A1 antibody: synthetic peptide directed towards the C terminal of human ALDH4A1. Synthetic peptide located within the following region: RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI
CPS1 Rabbit Polyclonal Antibody
TA338262

USD 310.00

5 Days

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the N terminal of human CPS1. Synthetic peptide located within the following region: QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
CPS1 Rabbit Polyclonal Antibody
TA338263

USD 310.00

5 Days

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
ALDH4A1 Rabbit Polyclonal Antibody
TA338296

USD 310.00

5 Days

Rabbit Polyclonal Anti-ALDH4A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH4A1 antibody: synthetic peptide directed towards the N terminal of human ALDH4A1. Synthetic peptide located within the following region: QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338397

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
AZIN2 Rabbit Polyclonal Antibody
TA340227

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADC Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ADC antibody: synthetic peptide directed towards the middle region of human ADC. Synthetic peptide located within the following region: RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH
eNOS (NOS3) Rabbit Polyclonal Antibody
TA354308

USD 355.00

5 Days

Rabbit anti eNOS Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence (residing in 550-650aa) of human eNOS protein. This sequence is identical among human, rat, mouse, bovine origins.
Creatine kinase B type (CKB) Goat Polyclonal Antibody
TA302453

USD 375.00

5 Days

Goat Polyclonal Antibody against CKB / Brain Creatine Kinase

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KPSDEHKTDLNPDN, from the internal region of the protein sequence according to NP_001814.2.