Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SLC2A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC2A2 antibody: synthetic peptide directed towards the N terminal of human SLC2A2. Synthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
GLUT2 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | SLC2A2 / GLUT2 antibody was raised against synthetic peptide C-RKEREEASSEQKVS from an internal region of human SLC2A2 / GLUT2 (NP_000331.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Panda, Bat, Rabbit, Horse, Pig (93%); Rat, Sheep, Elephant, Dog, Bovine (86%). |
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
USD 345.00
In Stock
Rabbit anti-JNK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | C term -peptide of human JNK2 |
Rabbit anti-PDX1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PDX1 |
Rabbit anti-Phospho-MAPK8/9/10-T183/Y185 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T183/Y185 of human MAPK8/MAPK9/MAPK10 |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
Rabbit Polyclonal JNK1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Anti-INS Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human Insulin produced in E. coli as a fusion protein. |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 5E4/3 (D6C4), Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit Polyclonal ERK1/2 (Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p44/42 MAP Kinase (Thr202) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p44/42 MAP Kinase around the phosphorylation site of Threonine 202 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit polyclonal p44 MAPK antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p44 MAPK. |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V). |
JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V). |
ERK1 (MAPK3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Insulin (INS) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ERK1 (MAPK3) (+ERK2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Germany
Japan
United Kingdom
China
