Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 47 of 47 results

(reset)

BDNF Rabbit Polyclonal Antibody

TA328615

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-BDNF

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

1 / 2

2 / 2

Previous Next

NGF Rabbit Polyclonal Antibody

TA349414

USD 380.00

In Stock

Rabbit Polyclonal Anti-NGF Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human NGF

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BDNF Rabbit Polyclonal Antibody

TA346304

USD 475.00

5 Days

Rabbit Polyclonal Anti-BDNF Antibody

Applications	IHC, WB
Reactivities	Human, Macaque, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BDNF Goat Polyclonal Antibody

TA348982

USD 429.00

5 Days

Goat Polyclonal Anti-BDNF Antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1.

1 / 3

2 / 3

3 / 3

Previous Next

BDNF Rabbit Polyclonal Antibody

TA327032

USD 275.00

3 Weeks

Rabbit anti-BDNF Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human BDNF

1 / 3

2 / 3

3 / 3

Previous Next

BDNF Rabbit Polyclonal Antibody

TA328614

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-proBDNF

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.

1 / 3

2 / 3

3 / 3

Previous Next

NGF Rabbit Monoclonal Antibody [Clone ID: EP1318Y]

TA301201

USD 509.00

In Stock

Rabbit Monoclonal Antibody against NGF (Clone EP1318Y)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

Fas Ligand (FASLG) Rabbit Polyclonal Antibody

TA347378

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-FASL Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL

NGF Rabbit Polyclonal Antibody

TA347902

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-NGF beta Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-NGF beta Antibody: A synthesized peptide derived from human NGF beta

NGF Rabbit Polyclonal Antibody

TA326803

USD 275.00

3 Weeks

Rabbit anti-NGF Polyclonal Antibody

Applications	WB
Reactivities	Mouse, Human
Conjugation	Unconjugated
Immunogen	A synthetic peptide of human NGF

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

TA328680

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-NT3

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide GEIKTGNSPV(C), corresponding to amino acid residues 39-48 of mature human NT-3 (residues 177-186 of the NT-3 precursor).

1 / 2

2 / 2

Previous Next

Neurotrophin 4 (NTF4) Rabbit Polyclonal Antibody

TA328674

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-NT4

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Peptide LGEVPAAGGSPL(C), corresponding to amino acid residues 43-52 of mature human NT-4Â (123-132 of the precursor NT-4).

1 / 2

2 / 2

Previous Next

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

TA328681

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-proNT-3

Applications	IHC, WB
Reactivities	Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)DTELLRQQRRYNSPR, corresponding to amino acid residues 89-103 of human NT-3 (precursor).Pro domain of the NT-3 protein.

1 / 3

2 / 3

3 / 3

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF500030

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI2D1]

CF500031

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

CF500032

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI4D2]

CF500033

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NT4 mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

CF500034

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT4 mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

NGF Rabbit Polyclonal Antibody

TA321493

USD 345.00

4 Weeks

Anti-NGF Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 80-94 amino acids of human nerve growth factor (beta polypeptide)

1 / 3

2 / 3

3 / 3

Previous Next

Neurotrophin 4 (NTF4) Rabbit Polyclonal Antibody

TA322527

USD 345.00

In Stock

Anti-NTF4 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BDNF Rabbit Polyclonal Antibody

TA323908

USD 345.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor

BDNF Rabbit Polyclonal Antibody

TA323909

USD 345.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 153-168 amino acids of Human brain-derived neurotrophic factor

Fas Ligand (FASLG) Rabbit Polyclonal Antibody

TA350662

USD 345.00

In Stock

Rabbit Polyclonal Anti-FASLG Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human FASLG

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

TA500030

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A2]

TA500030AM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A2]

TA500030BM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

TA500030S

USD 159.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI2D1]

TA500031

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]

TA500031AM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1), Biotinylated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D1]

TA500031BM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1), HRP conjugated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI2D1]

TA500031S

USD 159.00

2 Days

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA500032

USD 379.00

In Stock

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]

TA500032AM

USD 420.00

4 Weeks

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D4]

TA500032BM

USD 420.00

4 Weeks

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA500032S

USD 159.00

In Stock

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI4D2]

TA500033

USD 379.00

In Stock

NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D2]

TA500033AM

USD 420.00

4 Weeks

NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2), Biotinylated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D2]

TA500033BM

USD 420.00

4 Weeks

NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2), HRP conjugated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI4D2]

TA500033S

USD 159.00

2 Days

NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

TA500034

USD 379.00

In Stock

NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E8]

TA500034AM

USD 420.00

5 Days

NT4 mouse monoclonal antibody, clone 2E8, Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E8]

TA500034BM

USD 420.00

5 Days

NT4 mouse monoclonal antibody, clone 2E8, HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

TA500034S

USD 159.00

In Stock

NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500115

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C7]

TA500115AM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C7]

TA500115BM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500115S

USD 159.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

1 - 47 of 47 results