Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Goat Polyclonal Anti-BDNF Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit anti-BDNF Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BDNF |
Rabbit Polyclonal Anti-proBDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein. |
Rabbit Monoclonal Antibody against NGF (Clone EP1318Y)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FASL Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL |
Rabbit Polyclonal Anti-NGF beta Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NGF beta Antibody: A synthesized peptide derived from human NGF beta |
Rabbit anti-NGF Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human NGF |
Rabbit Polyclonal Anti-NT3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide GEIKTGNSPV(C), corresponding to amino acid residues 39-48 of mature human NT-3 (residues 177-186 of the NT-3 precursor). |
Rabbit Polyclonal Anti-NT4
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide LGEVPAAGGSPL(C), corresponding to amino acid residues 43-52 of mature human NT-4Â (123-132 of the precursor NT-4). |
Rabbit Polyclonal Anti-proNT-3
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DTELLRQQRRYNSPR, corresponding to amino acid residues 89-103 of human NT-3 (precursor).Pro domain of the NT-3 protein. |
Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NT4 mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NT4 mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-NGF Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 80-94 amino acids of human nerve growth factor (beta polypeptide) |
Anti-NTF4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4 |
Anti-BDNF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor |
Anti-BDNF Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 153-168 amino acids of Human brain-derived neurotrophic factor |
Rabbit Polyclonal Anti-FASLG Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FASLG |
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
NT4 mouse monoclonal antibody, clone 2E8, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
NT4 mouse monoclonal antibody, clone 2E8, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |