beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1. |
beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1. |
Goat Polyclonal Anti-beta-Catenin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli. |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
Applications | IF, IHC, WB |
Reactivities | Guinea Pig, Human |
Phospho-CREB1-S133 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S133 of human CREB1 |
Modifications | Phospho-specific |
Rabbit polyclonal MITF (Ab-180/73) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Modifications | Phospho-specific |
Phospho-CREB-Ser133 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Ser133 of human CREB |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
Rabbit Polyclonal Anti-CREB3L1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1. Synthetic peptide located within the following region: MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDF |
Rabbit Polyclonal Anti-P300/CBP Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein. |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TCF7L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal Anti-CREB1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CREB1 |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone EM-22, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Hamster, Human, Mouse |
EP300 (731-831) mouse monoclonal antibody, clone 1D2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein. |
Mouse Monoclonal KAT3B/p300 Antibody (RW128)
Applications | WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
CTNNB1 Capture mouse monoclonal antibody, Luminex validated, clone OTI2H3
Applications | ELISA, LMNX |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700034 |
CREB1 mouse monoclonal antibody, clone 3F1-1B2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
EP300 mouse monoclonal antibody, clone 1B1, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
MITF (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 8-36 amino acids from the N-terminal region of Human MITF. |
EP300 rabbit polyclonal antibody, Supernatant
Applications | ELISA, EMSA, IP, WB |
Reactivities | Human |
Immunogen | P300 peptide corresponding to a region near the N-terminus of the Human protein conjugated to KLH. |
Rabbit polyclonal Catenin-beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1. |
Rabbit polyclonal anti-P300/CBP antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human P300/CBP. |
Rabbit polyclonal MITF (Ser180/73) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MITF around the phosphorylation site of serine 73 (P-N-SP-P-M). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-TCF7L1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF7L1. |
Rabbit Polyclonal CREB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB |
Rabbit Polyclonal CREB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB. |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB around the phosphorylation site of Serine 133 |
Modifications | Phospho-specific |
Rabbit Polyclonal CREB (Ser142) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB around the phosphorylation site of Serine 142 |
Modifications | Phospho-specific |
Rabbit Polyclonal MITF (Ser180/73) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MITF around the phosphorylation site of Serine 180/73 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TCF7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF7. Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE |
Rabbit Polyclonal Anti-p300 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p300 Antibody: A synthesized peptide derived from human p300 |
Rabbit Polyclonal Anti-p300 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p300 Antibody: A synthesized peptide derived from human p300 |
Goat Polyclonal Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody: Peptide with sequence C-QIPSTQFDAAHPTN, from the internal region of the protein sequence according to NP_001895.1. |
USD 379.00
In Stock
CTNNB1 Capture mouse monoclonal antibody, Luminex validated, clone OTI9F6
Applications | LMNX |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700034 |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
Applications | IF, IHC, WB |
Reactivities | Chicken, Human, Rat |
CREB1 mouse monoclonal antibody, clone 5F2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CREB3L1 (C-term) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 488~517 amino acids from the C-terminal region of Human CREB3L1 |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) pSer37 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
CREB1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
CREB1 mouse monoclonal antibody, clone 86B10
Applications | FC, IF, WB |
Conjugation | Unconjugated |
Rabbit polyclonal Catenin-beta (Ab-489) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Rabbit polyclonal CREB (Ab-100) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CREB around the phosphorylation site of threonine 100 (S-G-TP-Q-I). |
Rabbit polyclonal CREB (Thr100) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of threonine 100 (S-G-TP-Q-I). |
Modifications | Phospho-specific |
Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-p300 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human p300. |