RRM2 mouse monoclonal antibody, clone 1E1, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
RRM2 mouse monoclonal antibody, clone 1E1, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
RRM2 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RRM2 |
RRM2 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human RRM2 |
Rabbit Polyclonal Anti-RRM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RRM2 antibody: synthetic peptide directed towards the N terminal of human RRM2. Synthetic peptide located within the following region: PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP |
Carrier-free (BSA/glycerol-free) RRM2 mouse monoclonal antibody,clone OTI3D3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM2 mouse monoclonal antibody,clone OTI1F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RRM2 mouse monoclonal antibody,clone OTI3D3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RRM2 mouse monoclonal antibody,clone OTI3D3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RRM2 mouse monoclonal antibody,clone OTI3D3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RRM2 mouse monoclonal antibody,clone OTI3D3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RRM2 mouse monoclonal antibody,clone OTI1F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RRM2 mouse monoclonal antibody,clone OTI1F2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RRM2 mouse monoclonal antibody,clone OTI1F2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RRM2 mouse monoclonal antibody,clone OTI1F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".