Germany
Japan
United Kingdom
China
Antibodies
View as table Download
FAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAS |
Goat Polyclonal Anti-INS Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human Insulin produced in E. coli as a fusion protein. |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
Insulin (INS) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Hamster, Human, Porcine, Rat |
| Immunogen | Synthetic Human proinsulin |
CD95 (FAS) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide selected from the Center region of human FAS |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
Insulin (INS) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | C-Peptide conjugate EAEDLQVGQVKKKC- KLH |
Insulin (INS) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | C-Peptide conjugate EAEDLQVGQVKKKC- KLH |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Rabbit anti CD95 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-INS Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human INS |
Active filters
Clonalities
- Polyclonal
Families
- ES Cell Differentiation/IPS
Pathways
- Type I diabetes mellitus