Germany
Japan
United Kingdom
China
Anti-PLCG1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa. 781~785 (G-F-Y-V-E) derived from Human PLC?1. |
Antibodies
View as table Download
Anti-PLCG2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human phospholipase C, gamma 2 (phosphatidylinositol-specific) |
Rabbit Polyclonal Anti-PIK3CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD |
Rabbit Polyclonal Anti-PIK3CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE |
Rabbit Polyclonal Anti-MINPP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MINPP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MINPP1. Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL |
Rabbit Polyclonal Anti-PIP4K2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIP4K2B Antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2B. Synthetic peptide located within the following region: DVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEIS |
Phospho-PLCG2-Y1217 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1217 of human PLCG2 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PLCB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLCB1 Antibody: synthetic peptide directed towards the middle region of human PLCB1. Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT |
Rabbit Polyclonal Anti-INPP5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-INPP5A Antibody is: synthetic peptide directed towards the C-terminal region of Human INPP5A. Synthetic peptide located within the following region: VVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVF |
Rabbit Polyclonal Anti-ITPK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the N terminal of human ITPK1. Synthetic peptide located within the following region: MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI |
Rabbit Polyclonal Anti-INPP5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5B antibody: synthetic peptide directed towards the middle region of human INPP5B. Synthetic peptide located within the following region: IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN |
Rabbit Polyclonal Anti-ISYNA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ISYNA1 Antibody: synthetic peptide directed towards the N terminal of human ISYNA1. Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD |
Rabbit Polyclonal Anti-PI4KB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the N terminal of human PI4KB. Synthetic peptide located within the following region: LILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSN |
Rabbit Polyclonal Anti-PI4KB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the middle region of human PI4KB. Synthetic peptide located within the following region: HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM |
Rabbit Polyclonal Anti-PIP4K2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIP4K2C antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2C. Synthetic peptide located within the following region: LKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHD |
Rabbit Polyclonal Anti-ALDH6A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW |
Rabbit Polyclonal Anti-ALDH6A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH6A1 antibody: synthetic peptide directed towards the middle region of human ALDH6A1. Synthetic peptide located within the following region: AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID |
Rabbit polyclonal Anti-PIP4K2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the middle region of human PIP4K2A. Synthetic peptide located within the following region: EQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNI |
Rabbit anti PLC gamma2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti PLC gamma 1 Polyclonal Antibody
| Reactivities | Human, Rat, Cw |
| Conjugation | Unconjugated |
Anti-ALDH6A1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1 |
Rabbit Polyclonal Anti-PIKFYV Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PIKFYV |
Rabbit Polyclonal Anti-PIP5K1B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PIP5K1B |
Rabbit Polyclonal Anti-PLCZ1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PLCZ1 |
USD 345.00
In Stock
INPP5K Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Clonalities
- Polyclonal
Pathways
- Inositol phosphate metabolism
Filter by
Category
Target Symbol
- PLCG1 (14)
- PTEN (13)
- PLCG2 (9)
- ALDH6A1 (6)
- TPI1 (6)
- PIK3CA (5)
- ITPK1 (4)
- MINPP1 (4)
- PIK3C3 (4)
- PIK3CB (4)
- PIK3CG (4)
- PLCB3 (4)
- IMPA2 (3)
- INPP5B (3)
- IPMK (3)
- IPPK (3)
- PI4KB (3)
- PIB5PA (3)
- PIK3CD (3)
- PIKFYVE (3)
- PIP4K2A (3)
- PLCB1 (3)
- PLCD1 (3)
- INPP4B (2)
- INPP5K (2)
- PIP5K1A (2)
- PIP5K1B (2)
- PLCB2 (2)
- SYNJ1 (2)
- IMPA1 (1)
- INPP1 (1)
- INPP5A (1)
- INPP5J (1)
- INPPL1 (1)
- ISYNA1 (1)
- ITPKB (1)
- PIK3C2A (1)
- PIK3C2G (1)
- PIP4K2B (1)
- PIP4K2C (1)
- PIP5K1C (1)
- PLCD3 (1)
- PLCZ1 (1)
- SYNJ2 (1)