Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-DDX58 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 909-925 amino acids of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 |
DDX58 goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DDX58 antibody was raised against synthetic peptide from human DDX58 / RIG-1 / RIG-I |
Rabbit Polyclonal Anti-DDX58 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX58 antibody: synthetic peptide directed towards the middle region of human DDX58. Synthetic peptide located within the following region: EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH |
Rabbit Polyclonal Anti-DDX58 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DDX58 |
Rabbit polyclonal anti-DDX58 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DDX58 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- DDX58
Clonalities
- Polyclonal
Pathways
- Cytosolic DNA-sensing pathway