Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-SEPT2 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Calbindin (CALB1) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Human, Monkey, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit polyclonal antibody to HN1 (hematological and neurological expressed 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 166 of HN1 (Uniprot ID#Q9UK76 isoform2) |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Anti-HSD3B1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Active filters
Reactivities
- Monkey
Clonalities
- Polyclonal
Filter by
Category
Target Symbol
- CANX (9)
- TP53 (6)
- GAPDH (5)
- RAB27A (5)
- ATXN3 (4)
- CHM (4)
- PCNA (4)
- PDIA3 (4)
- RAB5A (4)
- RAB9A (4)
- ACTB (3)
- ADAMTS1 (3)
- CELSR3 (3)
- ENPP3 (3)
- ENTPD2 (3)
- GJA1 (3)
- GLG1 (3)
- GPC4 (3)
- GPR4 (3)
- HSP90AB1 (3)
- HSPA1A (3)
- HSPA5 (3)
- KISS1R (3)
- MELTF (3)
- NCL (3)
- OLFM4 (3)
- OXGR1 (3)
- RAB11A (3)
- SLC1A4 (3)
- SOD2 (3)
- STIP1 (3)
- TUBA4A (3)
- VIM (3)
- ABCB1 (2)
- ADRA1B (2)
- AKT2 (2)
- ANXA5 (2)
- BDKRB1 (2)
- BEST4 (2)
- CALCRL (2)
- CCKAR (2)
- CCR4 (2)
- CD19 (2)
- CD63 (2)
- CD70 (2)
- CDH1 (2)
- CNR2 (2)
- CTSD (2)
- DPP4 (2)
- DRD2 (2)
- DRD3 (2)
- ENO1 (2)
- FBL (2)
- FFAR4 (2)
- GPR1 (2)
- GPR65 (2)
- GPRC6A (2)
- GRPR (2)
- HCAR1 (2)
- HCRTR1 (2)
- HSP90B1 (2)
- KCNJ6 (2)
- KCNMA1 (2)
- MAT2A (2)
- NANOG (2)
- NR2E3 (2)
- P2RX2 (2)
- PKM (2)
- POU5F1 (2)
- PTGDR (2)
- PTGES (2)
- PTH2R (2)
- PTPRC (2)
- RAB14 (2)
- RAB1B (2)
- RAB8A (2)
- RXFP3 (2)
- SLC11A2 (2)
- SLC1A5 (2)
- SLC39A14 (2)
- SLC5A9 (2)
- SLC6A3 (2)
- SRD5A2 (2)
- SURF4 (2)
- TAS1R1 (2)
- TM9SF3 (2)
- TSPAN13 (2)
- UCHL1 (2)
- WNT10A (2)
- WNT16 (2)
- WNT4 (2)
- WNT5B (2)
- AAMP (1)
- AAPK1 (1)
- ACKR4 (1)
- ACTN1 (1)
- ACTR3 (1)
- ADGRD1 (1)
- ADGRL3 (1)
- ADGRL4 (1)
Applications
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (448)
- Transmembrane (289)
- GPCR (109)
- ES Cell Differentiation/IPS (50)
- Secreted Protein (50)
- Transcription Factors (43)
- Stem cell - Pluripotency (35)
- Protease (21)
- Protein Kinase (16)
- Cancer stem cells (11)
- Adult stem cells (8)
- Induced pluripotent stem cells (7)
- Ion Channels: Other (7)
- Nuclear Hormone Receptor (7)
- Ion Channels: Potassium (6)
- Embryonic stem cells (5)
- P450 (5)
- Ion Channels: Transient receptor potential (4)
- Phosphatase (4)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Ion Channels: ATP Receptors (3)
- Ion Channels: Calcium (1)
- Ion Channels: Sodium (1)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
Pathways
- Neuroactive ligand-receptor interaction (76)
- Metabolic pathways (51)
- Pathways in cancer (48)
- Calcium signaling pathway (40)
- Wnt signaling pathway (26)
- Antigen processing and presentation (24)
- Basal cell carcinoma (23)
- Endocytosis (23)
- MAPK signaling pathway (23)
- Cytokine-cytokine receptor interaction (20)
- Prostate cancer (20)
- Melanogenesis (19)
- Alzheimer's disease (18)
- Focal adhesion (18)
- Hedgehog signaling pathway (18)
- Amyotrophic lateral sclerosis (ALS) (17)
- Huntington's disease (17)
- Progesterone-mediated oocyte maturation (17)
- Gap junction (16)
- Regulation of actin cytoskeleton (16)
- Cell cycle (15)
- Chemokine signaling pathway (15)
- Colorectal cancer (15)
- Adherens junction (14)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (14)
- Cell adhesion molecules (CAMs) (14)
- Vascular smooth muscle contraction (14)
- Endometrial cancer (13)
- Hematopoietic cell lineage (13)
- Pathogenic Escherichia coli infection (13)
- Purine metabolism (13)
- Apoptosis (12)
- Pancreatic cancer (12)
- Parkinson's disease (12)
- T cell receptor signaling pathway (12)
- Bladder cancer (11)
- Glycolysis / Gluconeogenesis (11)
- Leukocyte transendothelial migration (11)
- Melanoma (11)
- Neurotrophin signaling pathway (11)
- Non-small cell lung cancer (11)
- Glioma (10)
- NOD-like receptor signaling pathway (10)
- Prion diseases (10)
- Tight junction (10)
- VEGF signaling pathway (10)
- p53 signaling pathway (10)
- Chronic myeloid leukemia (9)
- Dilated cardiomyopathy (9)
- Fc epsilon RI signaling pathway (9)
- Fc gamma R-mediated phagocytosis (9)
- Hypertrophic cardiomyopathy (HCM) (9)
- Small cell lung cancer (9)
- Thyroid cancer (9)
- Toll-like receptor signaling pathway (9)
- B cell receptor signaling pathway (8)
- Insulin signaling pathway (8)
- Lysosome (8)
- GnRH signaling pathway (7)
- Natural killer cell mediated cytotoxicity (7)
- Renal cell carcinoma (7)
- Type II diabetes mellitus (7)
- mTOR signaling pathway (7)
- Adipocytokine signaling pathway (6)
- Androgen and estrogen metabolism (6)
- ErbB signaling pathway (6)
- Primary immunodeficiency (6)
- Viral myocarditis (6)
- Arginine and proline metabolism (5)
- Base excision repair (5)
- C21-Steroid hormone metabolism (5)
- Complement and coagulation cascades (5)
- DNA replication (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- Jak-STAT signaling pathway (5)
- Mismatch repair (5)
- Oocyte meiosis (5)
- PPAR signaling pathway (5)
- Ribosome (5)
- Vibrio cholerae infection (5)
- Allograft rejection (4)
- Asthma (4)
- Autoimmune thyroid disease (4)
- Cardiac muscle contraction (4)
- Cysteine and methionine metabolism (4)
- ECM-receptor interaction (4)
- Glutathione metabolism (4)
- Long-term depression (4)
- Long-term potentiation (4)
- Nicotinate and nicotinamide metabolism (4)
- Nucleotide excision repair (4)
- RIG-I-like receptor signaling pathway (4)
- Starch and sucrose metabolism (4)
- Systemic lupus erythematosus (4)
- Taste transduction (4)
- Tyrosine metabolism (4)
- Ubiquitin mediated proteolysis (4)
- Acute myeloid leukemia (3)
- Alanine (3)
- Arachidonic acid metabolism (3)
- Maturity onset diabetes of the young (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Oxidative phosphorylation (3)
- Pantothenate and CoA biosynthesis (3)
- Phenylalanine metabolism (3)
- RNA degradation (3)
- Riboflavin metabolism (3)
- Spliceosome (3)
- Tryptophan metabolism (3)
- Type I diabetes mellitus (3)
- aspartate and glutamate metabolism (3)
- ABC transporters (2)
- Axon guidance (2)
- Basal transcription factors (2)
- Caffeine metabolism (2)
- Citrate cycle (TCA cycle) (2)
- Dorso-ventral axis formation (2)
- Drug metabolism - cytochrome P450 (2)
- Drug metabolism - other enzymes (2)
- Fructose and mannose metabolism (2)
- Histidine metabolism (2)
- Olfactory transduction (2)
- One carbon pool by folate (2)
- Phenylalanine (2)
- Phosphatidylinositol signaling system (2)
- Pyruvate metabolism (2)
- Regulation of autophagy (2)
- Selenoamino acid metabolism (2)
- Sphingolipid metabolism (2)
- TGF-beta signaling pathway (2)
- tyrosine and tryptophan biosynthesis (2)
- Amino sugar and nucleotide sugar metabolism (1)
- D-Glutamine and D-glutamate metabolism (1)
- Ether lipid metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycine (1)
- Graft-versus-host disease (1)
- Inositol phosphate metabolism (1)
- Linoleic acid metabolism (1)
- Methane metabolism (1)
- N-Glycan biosynthesis (1)
- Nitrogen metabolism (1)
- Non-homologous end-joining (1)
- Notch signaling pathway (1)
- O-Glycan biosynthesis (1)
- Pentose phosphate pathway (1)
- Pyrimidine metabolism (1)
- Renin-angiotensin system (1)
- Retinol metabolism (1)
- SNARE interactions in vesicular transport (1)
- alpha-Linolenic acid metabolism (1)
- serine and threonine metabolism (1)