Germany
Japan
United Kingdom
China
Rabbit Polyclonal Rel Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Rel |
Antibodies
View as table Download
Rabbit Polyclonal Rel (Ser503) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Rel around the phosphorylation site of Serine 503 |
| Modifications | Phospho-specific |
c Rel (REL) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human |
| Immunogen | Synthesized non-phosphopeptide derived from human Rel around the phosphorylation site of serine 503 (T-S-SP-D-S) |
c Rel (REL) rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human |
| Immunogen | Synthesized non-phosphopeptide derived from human Rel around the phosphorylation site of serine 503 (T-S-SP-D-S) |
Rabbit Polyclonal Anti-REL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-REL antibody: synthetic peptide directed towards the N terminal of human REL. Synthetic peptide located within the following region: ASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQ |
Phospho-REL-S503 Rabbit Polyclonal Antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S503 of human REL |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-REL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-REL Antibody: synthetic peptide directed towards the middle region of human REL. Synthetic peptide located within the following region: CADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQ |
Rabbit Polyclonal Anti-Rel Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rel antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF |
Rabbit anti Rel (pS503) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -CSVNMMTTS-S-DSMGETD- with phosphorylation sites at Ser503 of c-Rel protein from human. |
REL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human REL (NP_002899.1). |
| Modifications | Unmodified |
c-Rel Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Rel |
Active filters
Target Symbol
- REL
Clonalities
- Polyclonal