Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit polyclonal FASN Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN. |
Rabbit polyclonal Acetyl-CoA Carboxylase (Ser80) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human: Ser80, Mouse: Ser79, Rat: Ser79 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human acetyl-CoA carboxylase around the phosphorylation site of serine 80 (S-M-SP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Acetyl-CoA Carboxylase (Ab-80) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Acetyl-CoA Carboxylase around the phosphorylation site of serine 80 (S-M-SP-G-L). |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 401 and 694 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit Polyclonal ACC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ACC1 |
Rabbit Polyclonal ACC1 (Ser80) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ACC1 around the phosphorylation site of Serine 80 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Rabbit polyclonal ACC1 (Ser80) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ACC1 around the phosphorylation site of serine 79 (S-M-SP-G-L). |
| Modifications | Phospho-specific |
USD 450.00
5 Days
USD 450.00
5 Days
Goat Anti-ACACB Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLGEPDLSDKDRKD, from the internal region of the protein sequence according to NP_001084.2. |
Anti-ACACA (Phospho-Ser79) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 79(S-M-S(p)-G-L) derived from Human Acetyl-CoA Carboxylase. |
| Modifications | Phospho-specific |
Anti-ACACA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.78-82(S-M-S-G-L) derived from Human Acetyl-CoA Carboxylase. |
Phospho-ACACA-S79 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S79 of human ACACA |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-OLAH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OLAH Antibody: synthetic peptide directed towards the N terminal of human OLAH. Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC |
Rabbit Polyclonal Anti-OLAH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OLAH Antibody: synthetic peptide directed towards the N terminal of human OLAH. Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC |
Rabbit Polyclonal Anti-OXSM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OXSM antibody: synthetic peptide directed towards the middle region of human OXSM. Synthetic peptide located within the following region: HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP |
Carrier-free (glycerol/BSA-free) MCAT mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MCAT mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MCAT mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
