EGF mouse monoclonal antibody, clone S-21, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EGF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Rabbit Polyclonal Anti-EGF Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
EGF rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EGF |
EGF mouse monoclonal antibody, clone S-146, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Biotinylated Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
Anti-Murine EGF Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine EGF |
Anti-Rat EGF Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Rat EGF |
EGF mouse monoclonal antibody, clone S-120, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-145, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-177, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-134, Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Biotinylated Anti-Murine EGF Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine EGF |
Pro-EGF Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Internal region (near the N terminus) (SRQERVCNIEKNVS) |
Rabbit polyclonal anti rec EGF (hu); neat antiserum
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti rec EGF (hu); purified rabbit IgG
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Asn-Ser-Asp-Ser-Glu-Cys-Pro-Leu-Ser-His-Asp- Gly-Tyr-Cys-Leu-His-Asp-Gly-Val-Cys-Met-Tyr-Ile-Glu-Ala-Leu-Asp-Lys- Tyr-Ala-Cys-Asn-Cys-Val-Val-Gly-Tyr-Ile-Gly-Glu-Arg-Cys-Gln-Tyr-Arg- Asp-Leu-Lys-Trp-Trp-Glu-Leu-Arg-OH (Disulfide bonds between Cys⁶ and Cys²⁰/Cys¹⁴ and Cys³¹/Cys³³ and Cys⁴²) coupled to a carrier protein. |
Carrier-free (BSA/glycerol-free) EGF mouse monoclonal antibody,clone OTI2F9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGF mouse monoclonal antibody,clone OTI8E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor |
Anti-EGF Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor |
EGF Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-250 of human EGF (NP_001954.2). |
Modifications | Unmodified |
EGF Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 850-950 of human EGF (NP_001954.2). |
Modifications | Unmodified |
EGF mouse monoclonal antibody,clone OTI2F9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody,clone OTI2F9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGF mouse monoclonal antibody,clone OTI8E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
EGF mouse monoclonal antibody,clone OTI8E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".