purified MUC1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2A5
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700445 |
purified MUC1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2A5
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700445 |
Rabbit Monoclonal Antibody against MUC1 (Clone EP1024Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
purified MUC1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1F3
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700445 |
Mouse Monoclonal MUC 1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal CD227/MUC1 (Tyr1229) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD227/MUC1 around the phosphorylation site of tyrosine 1229 (S-P-YP-E-K) |
Modifications | Phospho-specific |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
purified MUC1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4A5
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700445 |
Rabbit Polyclonal Anti-Phospho-CD227/MUC1(Tyr1229) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-CD227/MUC1(Tyr1229) Antibody: A synthesized peptide derived from human CD227/MUC1 around the phosphorylation site of Tyrosine 1229 |
Modifications | Phospho-specific |
Rabbit polyclonal CD227/MUC1 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CD227/MUC1. |
Rabbit polyclonal anti-PGRMC2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PGRMC2. |
Rabbit Polyclonal MUC1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | MUC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MUC1. The immunogen is located within the last 50 amino acids of MUC1 . |
Mouse monoclonal Anti-MUC1 Clone C-Mu1
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-MUC1 Clone SM3
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-MUC1 Clone HMFG1
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody,clone OTIA3E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody,clone OTI1F3
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal EMA Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MUC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1 |
Rabbit Polyclonal Anti-MUC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1 |
Rabbit Polyclonal Anti-MUC1(NT) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1(NT) |
Rabbit Polyclonal Anti-MUC1(CT) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1(CT) |
Epithelial Membrane Antigen Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1 |
MUC1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1182-1255aa of human MUC1 (NP_002708.1). |
Modifications | Unmodified |
Recombinant Anti-MUC1 (Clone SM3)
Applications | ELISA, FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone SM3)
Applications | ELISA, FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MUC1 (Clone Mc5)
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone Mc5)
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MUC1 (Clone HMFG2)
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone HMFG2)
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MUC1 (Clone HMFG1 (1.10.F3))
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone HMFG1 (1.10.F3))
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MUC1 (Clone PAM4)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone PAM4)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
MUC1 mouse monoclonal antibody,clone OTIA3E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 mouse monoclonal antibody,clone OTIA3E2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 mouse monoclonal antibody,clone OTI1F3
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 mouse monoclonal antibody,clone OTI1F3
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 (EMA) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 (EMA) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 (EMA) mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 (EMA) mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 (EMA) mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 (EMA) mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MUC1 (EMA) mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |