Germany
Japan
United Kingdom
China
Caldesmon (CALD1) rabbit monoclonal antibody, clone EP19, Supernatant
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
Antibodies
View as table Download
Rabbit polyclonal Bcl-6 (Ser333) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bcl-6 around the phosphorylation site of serine 333 (P-Q-SP-P-Q). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-BCL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BCL6 antibody is: synthetic peptide directed towards the C-terminal region of Human BCL6. Synthetic peptide located within the following region: IHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP |
Calponin (CNN1) rabbit monoclonal antibody, clone EP798Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Human |
CD14 rabbit monoclonal antibody, clone EPR3653, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal BCL6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | BCL6 antibody was raised against an 18 amino acid synthetic peptide near the center of human BCL6. |
MUC16 rabbit monoclonal antibody, clone EPR1020(2), Purified
| Applications | IHC |
| Reactivities | Human |
Rabbit polyclonal Bcl-6 (Ab-333) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Bcl-6 around the phosphorylation site of serine 333 (P-Q-SP-P-Q). |
Rabbit anti BCL-6 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- BCL6
Isotypes
- IgG
Families
- Druggable Genome