Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GAD1 Antibody: synthetic peptide directed towards the N terminal of human GAD1. Synthetic peptide located within the following region: MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF |
Rabbit Polyclonal Anti-ABAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT |
Rabbit Polyclonal Anti-ABAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW |
Rabbit Polyclonal Anti-ALDH9A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC |
Mouse Monoclonal ALDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Hamster |
| Conjugation | Unconjugated |
USD 380.00
4 Weeks
Mouse Monoclonal Aldehyde dehydrogenase 10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-ALDH9A1, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKEILDKFTEEVVKQ., from the internal region of the protein sequence according to NP_000687.3. |
Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 55-69 amino acids of Human glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) |
Anti-ALDH9A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ALDH3A2 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
DPYS Antibody
| Applications | WB |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
