Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-DNMT3A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE |
Rabbit Polyclonal DNMT1 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT1 antibody: mouse DNMT1 (DNA (cytosine-5)-methyltransferase 1), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the C-terminal part of the protein. |
Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein |
Rabbit Polyclonal DNMT2 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT2 antibody: mouse Dnmt2 (DNA methyltransferase 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the N-terminal part of the protein (1). |
DNMT3A Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DNMT3A |
DNMT3B Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DNMT3B |
Rabbit polyclonal Anti-DNMT3B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC |
Rabbit Polyclonal Anti-MPST Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPST antibody: synthetic peptide directed towards the middle region of human MPST. Synthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT |
Anti-DNMT1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1 |
Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338] |
CBSL rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CBS |
Goat Polyclonal Antibody against DNMT1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFESPPKTQPTEDN, from the internal egion of the protein sequence according to NP_001370.1. |
Anti-LDHB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (KLH-coupled) derived from human LDHB |
Mouse monoclonal DNMT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TAT mouse monoclonal antibody,clone OTI3G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-MAT1A Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-MAT1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-DNMT3L Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like |
Anti-DNMT3A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha |
Anti-AMD1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1 |
Anti-AMD1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1 |
Rabbit Polyclonal Anti-DNMT3A Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNMT3A |
Active filters
Reactivities
- Mouse
Families
- Druggable Genome
Pathways
- Cysteine and methionine metabolism