Antibodies

View as table Download

Rabbit anti-PRKACB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKACB

Rabbit Polyclonal Wnt10b Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b.

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

Mouse Monoclonal GSK-3 beta Antibody (3D10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated

Rabbit polyclonal anti-CKI-a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a.

Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C).
Modifications Phospho-specific

Goat Polyclonal Antibody against Casein Kinase 1, delta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1.

Goat Polyclonal Antibody against WNT4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2.

Goat Polyclonal Antibody against SMO (Internal region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1.

Rabbit polyclonal CK-1a (Tyr294) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CK-1a around the phosphorylation site of tyrosine 294 (Y-D-YP-T-F).
Modifications Phospho-specific

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.

Rabbit polyclonal anti-CKI-a1/L antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a1/L.

Anti-SUFU Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human suppressor of fused homolog (Drosophila)

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]

Rabbit Polyclonal Anti-BMP6 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Rabbit Polyclonal Anti-KAPC A/B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KAPC A/B Antibody: A synthesized peptide derived from human KAPC A/B

Rabbit polyclonal antibody to Dhh (desert hedgehog homolog (Drosophila))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 135 and 396 of Dhh (Uniprot ID#O43323)

Rabbit polyclonal PKA CAT (Ab-197) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C).

Rabbit polyclonal anti-KAPC A/B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAPC A/B.

Rabbit polyclonal anti-KAPCB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KAPCB.

Rabbit polyclonal anti-CKI-?1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CKI-?1.

Anti-WNT5A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A

Rabbit Polyclonal GSK3 beta (Ser9) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GSK3 beta around the phosphorylation site of Serine 9
Modifications Phospho-specific

Rabbit Polyclonal Wnt-5a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2.

Goat Polyclonal Antibody against WNT3

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CGRGHNTRTEKRKEK, from the internal region of the protein sequence according to NP_110380.1.

Goat Anti-ZIC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HSGLSSNFNEWY, from the C Terminus of the protein sequence according to NP_009060.2.

Rabbit polyclonal anti-SMO antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SMO.

Rabbit polyclonal GSK3beta (Ab-9) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GSK3β

Rabbit polyclonal Casein Kinase I a (Ab-321) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Casein Kinase I a around the phosphorylation site of threonine 321 (A-Q-TP-P-T).

Rabbit polyclonal anti-GLI-3 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GLI-3.

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).

Rabbit polyclonal anti-BMP-6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human BMP-6

Rabbit Polyclonal GSK3 beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GSK3 beta

Rabbit Polyclonal Anti-BMP5 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG

Goat Anti-RAB23 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-PNKQRTKKNRNP, from the C Terminus of the protein sequence according to NP_057361.3; NP_899050.1.

Rabbit Polyclonal Patched 1 Antibody

Applications WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 269-279 of the human and mouse PTCH protein.

Rabbit polyclonal GSK3beta (Ser9) antibody(Phospho-specific)

Applications WB
Reactivities Human: Ser9, Mouse: Ser9, Rat: Ser9
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human GSK3β
Modifications Phospho-specific

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (100%); Opossum (86%).

WNT4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen WNT4 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant (94%); Opossum (88%).

Rabbit polyclonal anti-Wnt1 antibody

Applications WB
Reactivities Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein.

Rabbit polyclonal anti-ZIC-2 antibody

Applications WB
Reactivities Chimpanzee, Human, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding amino acids 189-206 of Mouse ZIC-2.

Anti-BTRC Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 50-340 amino acids of human beta-transducin repeat containing E3 ubiquitin protein ligase

Rabbit polyclonal GSK-3Beta Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the sequence near the C-terminus of human GSK-3Beta.

Rabbit anti-BMP7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP7

Rabbit anti Glycogen Synthase Kinase 3b (GSK3b) Polyclonal Antibody

Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti GSK3b(Paired S9) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -TTSFA- without phosphorylation of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species

Rabbit anti GSK3b(pS9) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -TTSFA- with a phosphorylation site at Ser9 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species.

Rabbit anti GSK-3b (pY216) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -NVSYI- with a phosphorylation site at Tyr216 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species.

Rabbit anti GSK-3b (Paired Y216) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -NVSYI- without phosphorylation at Tyr216 of human GSK3-beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species

Rabbit anti GSK-3b Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of GSK-3beta protein. This sequence is identical among human, mouse, rat, bovine, dog and chicken species.