Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43 |
Rabbit polyclonal Connexin 43 (Ser265) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Connexin 43 around the phosphorylation site of Serine 265. |
| Modifications | Phospho-specific |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit Polyclonal Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Connexin 43 |
Rabbit polyclonal anti-CACNG1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Rabbit polyclonal anti-CACNA2D4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4. |
Rabbit polyclonal CACNA2D3 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1026-1053 amino acids from the C-terminal region of human CACNA2D3. |
Rabbit Polyclonal Connexin 43 (Ser367) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Connexin 43 around the phosphorylation site of Serine 367 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CACNA2D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI |
Rabbit Polyclonal Anti-CACNG6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
Goat Polyclonal Antibody against CACNB4 (internal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DYPDSYQDTYKPH, from the internal region (near the C Terminus) of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1. |
Goat Polyclonal Antibody against CACNA2D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QEIFNKYNKDKKVR, from the internal region of the protein sequence according to NP_000713.2. |
Goat Anti-Connexin 43 / GJA1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QPFDFPDDNQNSKK, from the internal region of the protein sequence according to NP_000156.1. |
Goat Anti-CACNB2 (aa565-579) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ECNKQRSRHKSKDRY, from the C Terminus of the protein sequence according to NP_000715.2; NP_963890.2; NP_963884.2; NP_963891.1; NP_963887.2; NP_963865.2; NP_963864.1; NP_963866.2; NP_001161417.1. |
Rabbit polyclonal anti-CACNG7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG7. |
Mouse monoclonal CaVbeta4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CACNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CACNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNB3. Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS |
Rabbit polyclonal Anti-CACNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG1 antibody: synthetic peptide directed towards the N terminal of human CACNG1. Synthetic peptide located within the following region: SKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSL |
Rabbit polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-CACNA2D4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D4 antibody is: synthetic peptide directed towards the middle region of Human CACNA2D4. Synthetic peptide located within the following region: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV |
Rabbit Polyclonal Anti-CACNA2D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNA2D2 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNA2D2. Synthetic peptide located within the following region: NCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELV |
Rabbit Polyclonal Anti-CACNB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the C terminal of human CACNB4. Synthetic peptide located within the following region: LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS |
Rabbit Polyclonal Anti-CACNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH |
Rabbit Polyclonal Anti-CACNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the n terminal of human CACNB3. Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: DYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRT |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: TDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQE |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS |
Rabbit Polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-CACNG6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: ACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: AYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRTDRSA |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: DACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQG |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGD |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASH |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: ADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVV |
Rabbit Polyclonal Anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2. Synthetic peptide located within the following region: SRKSTPPSSGAKSADEQDQWKTAGLFWRFTTEHTPPYDVVPSMRPVVLVG |
Rabbit Polyclonal Anti-GJA1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Rabbit, Pig, Opossum, Guinea pig (100%); Bat, Horse, Chicken, Lizard, Xenopus (94%); Trout, Salmon (88%); Zebrafish, Sea anemone, Nematode (81%). |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the C terminal of human CACNB1. Synthetic peptide located within the following region: RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQE |
Active filters
Reactivities
- Human
Families
- Ion Channels: Other
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC)