Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Phospho-SHP-1 (Tyr536) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyrosine 536 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PTP1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Rabbit Polyclonal Anti-Cdc25b Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cdc25b antibody is synthetic peptide directed towards the middle region of Mouse Cdc25b. Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK |
Rabbit Polyclonal Anti-SHPS1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHPS1 Antibody: A synthesized peptide derived from human SHPS1 |
Rabbit Polyclonal Anti-PTPN22 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22 |
Rabbit Polyclonal Anti-DUSP16 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DUSP16 Antibody: A synthesized peptide derived from human DUSP16 |
Rabbit Polyclonal Anti-ILKAP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ILKAP Antibody: A synthesized peptide derived from human ILKAP |
Rabbit Polyclonal Anti-Phospho-CDC25A(Ser75) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-CDC25A(Ser75) Antibody: A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Antibody against DUSP16
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AHEMIGTQIVTER-C, from the N Terminus of the protein sequence according to NP_085143.1. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal CDC25A (Ab-178) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
Rabbit polyclonal anti-PPP2R5A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP2R5A. |
Rabbit polyclonal anti-PPM1L antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPM1L. |
Rabbit polyclonal anti-PP4R2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PP4R2. |
Anti-PTP4A2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-164 amino acids of human protein tyrosine phosphatase type IVA, member 2 |
Rabbit Polyclonal CDC25A (Ser124) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 124 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser178) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 178 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 75 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDC25B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B |
Rabbit Polyclonal CDC25B (Ser323) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 323 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MKP-1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MKP-1/2 |
Rabbit Polyclonal CD45 (Ser1007) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD45 around the phosphorylation site of Serine 1007 |
| Modifications | Phospho-specific |
Rabbit polyclonal DUSP10 antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DUSP10. |
Rabbit Polyclonal Phospho-PTP1B (Ser50) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B around the phosphorylation site of Serine 50 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-CDC25A (Thr507) Antibody (Phospho-specific)
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Threonine 507 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-SHP-2 (Tyr542) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 around the phosphorylation site of Tyrosine 542 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-SHP-2 (Tyr580) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 around the phosphorylation site of Tyrosine 580 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SHP-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-1 |
Rabbit Polyclonal PTEN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Rabbit Polyclonal SHP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 |
Rabbit Polyclonal SHP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 |
Rabbit Polyclonal Antibody against CTDSP1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CTDSP1-V250 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-261 amino acids from the C-terminal region of human CTDSP1-V250. |
Goat Polyclonal Antibody against MTM1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SSPSQMMPHVQTHF, from the C Terminus of the protein sequence according to NP_000243.1. |
Goat Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RQQVKDNAKWYITD, from the C-Terminus of the protein sequence according to NP_004568.2. |
Active filters
Reactivities
- Mouse
Families
- Phosphatase
Filter by
Category
Target Symbol
- PTPRE (67)
- CTDSP1 (47)
- CDKN3 (46)
- PPM1B (45)
- DUSP5 (30)
- PTPN11 (29)
- PPP2R5D (27)
- MTMR14 (25)
- DUSP1 (24)
- DUSP10 (23)
- DAPP1 (20)
- DUSP29 (20)
- MTMR2 (20)
- CDC25A (18)
- PPM1D (17)
- PPP2R1B (16)
- PPP4C (16)
- PTPN7 (16)
- PTEN (13)
- DUSP4 (12)
- CTDSP2 (11)
- PPP1R7 (10)
- PPP3CA (10)
- PPP1CA (8)
- PPP3CB (8)
- DUSP23 (6)
- DUSP3 (6)
- PTPRC (6)
- CDC25B (5)
- DUSP6 (5)
- PPM1G (5)
- PPP1CB (5)
- PPP2R1A (5)
- PPP4R4 (5)
- PTPN6 (5)
- ACPP (4)
- DUSP16 (4)
- DUSP8 (4)
- PTP4A2 (4)
- DUSP22 (3)
- PPP1CC (3)
- PPP2CA (3)
- PPP2R2A (3)
- PTPN22 (3)
- PTPN5 (3)
- PTPRM (3)
- SIRPA (3)
- CDC25C (2)
- DUSP12 (2)
- DUSP26 (2)
- EPM2A (2)
- ILKAP (2)
- MTMR7 (2)
- PPP2CB (2)
- PPP2R5B (2)
- PSPH (2)
- PTN (2)
- PTPA (2)
- PTPN1 (2)
- PTPRJ (2)
- PTPRK (2)
- SET (2)
- CILP (1)
- DUSP13 (1)
- DUSP14 (1)
- DUSP19 (1)
- DUSP2 (1)
- DUSP7 (1)
- EYA1 (1)
- MTM1 (1)
- MTMR4 (1)
- PDP1 (1)
- PDP2 (1)
- PPM1K (1)
- PPM1L (1)
- PPP1R1C (1)
- PPP2R2C (1)
- PPP2R2D (1)
- PPP2R3A (1)
- PPP2R5A (1)
- PPP2R5E (1)
- PPP4R2 (1)
- PPP6C (1)
- PTP4A1 (1)
- PTP4A3 (1)
- PTPN12 (1)
- PTPN2 (1)
- PTPN20 (1)
- PTPN3 (1)
- PTPN4 (1)
- PTPRN2 (1)
- PTPRZ1 (1)
- SSH3 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- MAPK signaling pathway (198)
- Oocyte meiosis (93)
- Wnt signaling pathway (75)
- Natural killer cell mediated cytotoxicity (52)
- Tight junction (44)
- B cell receptor signaling pathway (43)
- Jak-STAT signaling pathway (34)
- Long-term potentiation (34)
- Epithelial cell signaling in Helicobacter pylori infection (30)
- p53 signaling pathway (30)
- Adipocytokine signaling pathway (29)
- Chronic myeloid leukemia (29)
- Focal adhesion (29)
- Leukocyte transendothelial migration (29)
- Neurotrophin signaling pathway (29)
- Renal cell carcinoma (29)
- T cell receptor signaling pathway (29)
- Long-term depression (26)
- Riboflavin metabolism (26)
- TGF-beta signaling pathway (26)
- Cell cycle (25)
- Progesterone-mediated oocyte maturation (25)
- Metabolic pathways (24)
- Fructose and mannose metabolism (22)
- Thiamine metabolism (22)
- Alzheimer's disease (18)
- Amyotrophic lateral sclerosis (ALS) (18)
- Apoptosis (18)
- Axon guidance (18)
- Calcium signaling pathway (18)
- Insulin signaling pathway (18)
- VEGF signaling pathway (18)
- Regulation of actin cytoskeleton (17)
- Vascular smooth muscle contraction (16)
- Endometrial cancer (13)
- Glioma (13)
- Inositol phosphate metabolism (13)
- Melanoma (13)
- Pathways in cancer (13)
- Phosphatidylinositol signaling system (13)
- Prostate cancer (13)
- Small cell lung cancer (13)
- Adherens junction (12)
- Cell adhesion molecules (CAMs) (9)
- Fc gamma R-mediated phagocytosis (6)
- Primary immunodeficiency (6)
- Glycine (2)
- serine and threonine metabolism (2)
- Type I diabetes mellitus (1)