CDK1 mouse monoclonal antibody, clone IMD-34, Purified
Applications | IHC, WB |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
CDK1 mouse monoclonal antibody, clone IMD-34, Purified
Applications | IHC, WB |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Apc1 (ANAPC1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
HSP90AB1 (250-325) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide between aa 250-325 in the sequence of human Hsp90 |
Cyclin B1 (CCNB1) (Center) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 248-275 amino acids from the Central region of human CCNB1 |
Cyclin B1 (CCNB1) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 388-418 amino acids from the C-terminal region of human CCNB1 |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit Polyclonal Antibody against CDC2 (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human CDC2. |
Rabbit Polyclonal APC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | APC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human APC1. |
Rabbit Polyclonal anti-HSP90AB1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human Hsp90beta. |
Rabbit polyclonal Cyclin B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Anti-Cyclin B1 antibody was produced by repeated immunizations of full length fusion protein corresponding to the human gene. |
Rabbit polyclonal APC1 phospho S377 antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 373-382 of Human Apc1 protein. |
Modifications | Phospho-specific |
Rabbit Polyclonal Cyclin B1 (Ser147) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin B1 around the phosphorylation site of Serine 147 |
Modifications | Phospho-specific |
Mouse monoclonal Hsp90 complex Antibody
Applications | IP |
Reactivities | Human, Mouse, Rat, Rabbit. Not tested on other species |
Conjugation | Unconjugated |
Rabbit polyclonal Hsp90 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length protein Hsp90 |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the N terminal of human CDC2. Synthetic peptide located within the following region: EDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIRE |
Rabbit Polyclonal HSP90 beta Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human Hsp90B protein (between residues 1-50) [UniProt P08238] |
Rabbit anti CDC2 (pY15) (CDK1) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- with a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit anti CDC2 (Paired Y15) (CDK1) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- without a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit anti CDC2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins |
CDC25C mouse monoclonal antibody, clone IMD-25, Aff - Purified
Applications | WB |
Reactivities | Human |
HSP90AB1 mouse monoclonal antibody, clone SJ-90, Purified
Applications | WB |
Reactivities | Chicken, Frog, Human, Mouse, Rabbit, Rat |
CDK1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Antibody against CDC2 (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-241 amino acids from the C-terminal region of human CDC2. |
Mouse Monoclonal anti-HSP90AB1 Antibody
Applications | IHC |
Reactivities | Humann, Rabbit, Rat, Mouse, Chicken |
Conjugation | Unconjugated |
Mouse Monoclonal anti-HSP90AB1 Antibody
Applications | WB |
Reactivities | Chicken, Human, Rabbit, Rat, Dog |
Conjugation | Unconjugated |
Mouse Monoclonal anti-HSP90AB1 Antibody
Applications | IP |
Reactivities | Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit anti-HSP90B (Phospho-Ser254) polyclonal antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Modifications | Phospho-specific |
Rabbit polyclonal Cyclin B1 (Ab-147) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 147 (A-F-SP-D-V). |
Rabbit polyclonal APC1(Ser355) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human APC1 around the phosphorylation site of serine 355 (A-H-SP-P-A). |
Modifications | Phospho-specific |
Rabbit polyclonal Cyclin B1 phospho S126 antibody
Applications | WB |
Reactivities | Human, Rat, Dog, Chimpanzee, Mouse, Hamster |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 120-131 of Human Cyclin B1 protein. |
Rabbit polyclonal APC1 phospho S355 antibody (Phospho-specific)
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 351-359 of Human Apc1 protein. |
Modifications | Phospho-specific |
Anti-HHSP90B1 (Phospho-Ser254) Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 254 (V-G-S(p)-D-E) derived from Human HSP90B. |
Modifications | Phospho-specific |
Anti-CDC25C Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human cell division cycle 25C |
Mouse monoclonal Hsp90 Antibody
Applications | IHC |
Reactivities | Human, Rabbit, Rat, Mouse, Chicken, Achyla, Wheat Germ, Sf9 cell line |
Conjugation | Unconjugated |
Mouse Monoclonal anti-Cyclin B1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: KLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGT |
Rabbit Polyclonal Anti-CCNA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2. Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL |
Phospho-CDK1-Y15 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y15 of human CDK1 |
Modifications | Phospho-specific |
Mouse monoclonal Anti-CyclinA Clone AT10.2
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-pTpY cdk1 Clone CP3.2
Reactivities | Frog, Mammalian |
Conjugation | Unconjugated |
Rabbit anti Somatostatin Receptor 1 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti Cyclin B1 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human cyclin B1 protein. |
Rabbit anti HSP84 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti Cyclin A Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti CDC25C(pS216) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSP90AB1 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-CDK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1 |