HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit anti-HPRT1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HPRT1 |
Rabbit Polyclonal Anti-HPRT1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
HPRT (HPRT1) mouse monoclonal antibody, clone AT2G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
HPRT (HPRT1) mouse monoclonal antibody, clone AT2G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
HPRT (HPRT1) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human HPRT1 |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HPRT1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HPRT1 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HPRT1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HPRT1 mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HPRT1 mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Special Offer: Get this product for $99/€99. Use code: "Truesample".