Goat Polyclonal Antibody against FOXC1
Applications | FC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RTSGAFVYDCSKF, from the C Terminus of the protein sequence according to NP_001444.1. |
Goat Polyclonal Antibody against FOXC1
Applications | FC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RTSGAFVYDCSKF, from the C Terminus of the protein sequence according to NP_001444.1. |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit polyclonal anti-TBP antibody, Loading control
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit Polyclonal antibody to PCAF (K(lysine) acetyltransferase 2B)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 767 and 832 of PCAF (Uniprot ID#Q92831) |
Rabbit Polyclonal Antibody against TARDBP
Applications | WB |
Reactivities | Human, Primate, Mouse, Xenopus, Zebrafish, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148] |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal CAF-1 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
Rabbit polyclonal SMAD2 Antibody
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2. |
Goat Polyclonal Anti-MNSOD (aa119-130) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Zebrafish, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MNSOD (aa119-130) Antibody: Peptide with sequence C-EAIKRDFGSFDK, from the internal region of the protein sequence according to NP_000627.2; NP_001019637.1. |
Goat Polyclonal Antibody against TCF2 / VHNF1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1. |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit polyclonal beta Catenin antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit polyclonal PITX2 Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PITX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-151 amino acids from the C-terminal region of human PITX2. |
Rabbit polyclonal antibody to ACAD8 (acyl-Coenzyme A dehydrogenase family, member 8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 415 of ACAD8 (Uniprot ID#Q9UKU7) |
Rabbit polyclonal anti-SMAD3 antibody
Applications | IHC, WB |
Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit polyclonal TADA3L Antibody (C-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TADA3L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 386-414 amino acids from the C-terminal region of human TADA3L. |
Rabbit polyclonal SMAD2 Antibody (T220)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 201-230 amino acids from human SMAD2. |
Rabbit Polyclonal anti-FOSL2 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY |
Goat Polyclonal Antibody against FOXP2 (Internal region)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DEVEYQKRRSQKIT, from the internal region of the protein sequence according to NP_055306.1; NP_683696.1; NP_683697.1; NP_683698.1. |
Rabbit polyclonal anti-MECT1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Zebrafish, Pufferfish, Bovine |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-34 of human MECT1 protein. |