Antibodies

View as table Download

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications Phospho-specific

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

Rabbit polyclonal anti-PGC-1alpha antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha

Rabbit anti-NFKBIB Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NFKBIB

Mouse Monoclonal RelA/NFkB p65 Antibody (112A1021)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K).
Modifications Phospho-specific

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1

Rabbit Polyclonal Anti-PPARGC1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS

Rabbit anti-IKBKG Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IKBKG

Rabbit Polyclonal Anti-MALT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MALT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human MALT1.

Rabbit anti-PPARGC1A polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human PGC-1.

Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932
Modifications Phospho-specific

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit Polyclonal NFkB1/NFkB p105 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838]

Rabbit Polyclonal Antibody against STAT3 (Phospho-STAT3-Y727 ) (Phospho-Specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This STAT3 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S727 of human STAT3.
Modifications Phospho-specific

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.

Anti-PRKCQ (Phospho-Ser676) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 676 (R-L-S(p)-F-A) derived from Human PKC?.
Modifications Phospho-specific

Rabbit Polyclonal NF- kappaB p65 (Ser536) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p65 around the phosphorylation site of Serine 536
Modifications Phospho-specific

Rabbit polyclonal STAT3 (Ab-705) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT3 around the phosphorylation site of tyrosine 705.

IKBKB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IKBKB

Rabbit Polyclonal NF-kappaB p65 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF-kappaB p65

Rabbit polyclonal IKK-gamma (Ser85) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R).
Modifications Phospho-specific

Rabbit polyclonal IKK-gamma (Ab-85) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R)

Rabbit polyclonal NF-kB p65 (Ab-311) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of serine 311 (F-K-SP-I-M).

Rabbit polyclonal PKC theta (Ser695) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKC ? around the phosphorylation site of serine 695 (N-F-SP-F-M).
Modifications Phospho-specific

Rabbit polyclonal anti-CAMKK2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CAMKK2.

Anti-PRKCQ Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa. 674~678 (R-L-S-F-A) derived from Human PKC?.

Rabbit polyclonal STAT3 (Phospho-Tyr705) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human STAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K).
Modifications Phospho-specific

Mouse Monoclonal IKK beta Antibody (10AG2)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT

Rabbit Polyclonal Anti-NF-kB p65 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NF-?B p65 Antibody: A synthesized peptide derived from human NF-?B p65
TNF

USD 320.00

In Stock

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.

Goat Polyclonal Antibody against RXRA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1.

Rabbit polyclonal TNF Receptor-1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1.

Rabbit polyclonal NF-kB p65(Ab-276) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of Serine 276.

Rabbit polyclonal NF-kB p65 (Ser281) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NF-kB p65 around the phosphorylation site of serine 281 (E-L-SP-E-P)
Modifications Phospho-specific

Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Ser23, Mouse: Ser23, Rat: Ser23
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23.
Modifications Phospho-specific

Rabbit polyclonal IkB-epsilon (Ab-22) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human I?B-e around the phosphorylation site of serine 22 (I-E-SP-L-R).

Rabbit Polyclonal STAT3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal STAT3 antibody was raised against a 19amino acid peptide near the amino terminus of human STAT3.

Anti-PPARA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-18 amino acids of human peroxisome proliferator-activated receptor alpha

Anti-STAT3 (Phospho-Ser727) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 727 (P-M-S(p)-P-R) derived from Human STAT3.
Modifications Phospho-specific

Anti-PRKCQ (Phospho-Ser695) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 695 (N-F-S(p)-F-M) derived from Human PKC?.
Modifications Phospho-specific

Rabbit polyclonal Phospho-STAT3(S727) Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This STAT3 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S727 of human STAT3.
Modifications Phospho-specific

Rabbit Polyclonal IKK-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-beta

Rabbit Polyclonal IKK- beta (Tyr188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 188
Modifications Phospho-specific

Rabbit Polyclonal IKK- beta (Tyr199) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 199
Modifications Phospho-specific

Rabbit Polyclonal NF-kappaB p105/p50 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF-kappaB p105/p50

Rabbit Polyclonal NF- kappaB p105/p50 (Ser337) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 337
Modifications Phospho-specific

Rabbit Polyclonal NF- kappaB p105/p50 (Ser927) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 927
Modifications Phospho-specific

Rabbit Polyclonal IkappaB-beta Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IkappaB-beta