USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 4A11 Clone M25-P2A10
Applications | IHC, WB |
Reactivities | Drosophila, Human, Mouse, Rat, Xenopus |
Conjugation | Unconjugated |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 4A11 Clone M25-P2A10
Applications | IHC, WB |
Reactivities | Drosophila, Human, Mouse, Rat, Xenopus |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Cytochrome P450 8B1 Clone M15-P3B7
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
CD36 mouse monoclonal antibody, clone TR9, APC
Applications | FC |
Reactivities | Human |
Conjugation | APC |
CD36 mouse monoclonal antibody, clone CB38 (NL07), Purified
Applications | FC |
Reactivities | Human |
ACSL3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 527-556 amino acids from the C-terminal region of human ACSL3 |
CPT1B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 743-771 amino acids from the C-terminal region of Human CPT1B |
CPT1C (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 584-614 amino acids from the C-terminal region of Human CPT1C. |
Goat Polyclonal Antibody against ACSL5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RTQIDSLYEHIQD, from the C Terminus of the protein sequence according to NP_057318.2; NP_976313.1; NP_976314.1. |
Goat Anti-CPT1B (isoform 1) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DIADLFQVPKAYS, from the C Terminus of the protein sequence according to NP_689452.1; NP_689451.1; NP_004368.1; NP_001138609.1; NP_001138607.1; NP_001138606.1; NP_001138608.1. |
Rabbit Polyclonal ACSL1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an N-terminal portion of the human ACSL1 protein (within residues 1-100). [Swiss-Prot# P33121] |
Rabbit Polyclonal SCD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 50-100). [Swiss-Prot# O00767] |
Goat Anti-FACL4 / ACSL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HYLKDIERMYGGK, from the C Terminus of the protein sequence according to NP_004449.1; NP_075266.1. |
Rabbit polyclonal anti-ACSL6 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACSL6. |
Mouse Anti-Human CD36 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-AQP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AQP7 antibody: synthetic peptide directed towards the C terminal of human AQP7. Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA |
Rabbit anti-ACSL5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACSL5 |
Rabbit Polyclonal Anti-SLC27A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC27A4 Antibody: synthetic peptide directed towards the middle region of human SLC27A4. Synthetic peptide located within the following region: YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL |
Rabbit Polyclonal CD36/SR-B3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human CD36 amino acids 99-124. |
Rabbit Polyclonal Anti-ACSL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL4 antibody: synthetic peptide directed towards the N terminal of human ACSL4. Synthetic peptide located within the following region: AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK |
Rabbit Polyclonal Anti-CYP8B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP8B1 antibody: synthetic peptide directed towards the middle region of human CYP8B1. Synthetic peptide located within the following region: SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP |
Mouse monoclonal Anti-Thrombospondin receptor Clone SMT
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | FC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPT1B mouse monoclonal antibody,clone OTI2A6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPT1B mouse monoclonal antibody,clone OTI6B8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI1D4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI6B5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI1C6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI3A3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-OLR1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human oxidized low density lipoprotein (lectin-like) receptor 1 |
Anti-SLC27A1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 630-646 amino acids of human solute carrier family 27 (fatty acid transporter), member 1 |
Anti-SLC27A1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 630-646 amino acids of human solute carrier family 27 (fatty acid transporter), member 1 |
Anti-CPT1A Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver) |
Anti-CPT1A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver) |
Rabbit Polyclonal Anti-ACSL4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACSL4 |
Rabbit Polyclonal Anti-OLR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OLR1 |
Rabbit Polyclonal Anti-CYP4A11 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP4A11 |
Rabbit Polyclonal Anti-SLC27A2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SLC27A2 |
Rabbit Polyclonal Anti-OLR1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human OLR1 |
Rabbit Polyclonal Anti-CD36 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD36 |
Rabbit Polyclonal Anti-CYP7A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP7A1 |
Rabbit Polyclonal Anti-SCD Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCD |
Rabbit Polyclonal Anti-SLC27A5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC27A5 |
Rabbit Polyclonal Anti-AQP7 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AQP7 |
OLR1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human OLR1 |
SCD5 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |