Germany
Japan
United Kingdom
China
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified
| Applications | ELISA, FN |
| Reactivities | Human |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Purified
| Applications | FC |
| Reactivities | Human |
CD28 mouse monoclonal antibody, clone B-T3, Purified
| Applications | FC, IHC |
| Reactivities | Human |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
IL12B mouse monoclonal antibody, clone 1-1A4, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
Goat Anti-CD28 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SQQLQVYSKTGFNCD, from the internal region of the protein sequence according to NP_006130.1. |
Mouse Anti-Human HLA-E Purified (25 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal HLA-G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HLA-A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
purified CD80 Capture mouse monoclonal antibody, Luminex validated, clone OTI2E5
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700489 |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | HRP |
CD28 mouse monoclonal antibody, clone CD28.2, APC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | APC |
CD28 mouse monoclonal antibody, clone CD28.2, FITC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | FITC |
CD28 mouse monoclonal antibody, clone CD28.2, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
CD28 mouse monoclonal antibody, clone B-T3, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD28 mouse monoclonal antibody, clone B-T3, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Purified
| Applications | FC |
| Reactivities | Human |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
TNF alpha (TNF) mouse monoclonal antibody, clone B-C7, Azide Free
| Applications | FN |
| Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone B-D9, FITC
| Applications | FC |
| Conjugation | FITC |
TNF alpha (TNF) mouse monoclonal antibody, clone B-D9, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
IL12B rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HLAB (HLA-B) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 184-212 amino acids from the Central region of human HLA-B |
HLA DMB (HLA-DMB) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 103-133 amino acids from the Central region of human HLA class II DM beta / HLA-DMB |
Rabbit polyclonal antibody to HLA-DRB1 (major histocompatibility complex, class II, DR beta 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 56 and 250 of HLA-DRB1 (Uniprot ID#P01912) |
Rabbit polyclonal antibody to HLA-DRB3 (major histocompatibility complex, class II, DR beta 3)
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 4 and 266 of HLA-DRB3 (Uniprot ID#P79483) |
Rabbit polyclonal antibody to HLA-DRB4 (major histocompatibility complex, class II, DR beta 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 266 of HLA DR beta (Uniprot ID#P13762) |
Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2. |
Mouse Anti-Human CD28 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Hamster Anti-Mouse CD80 (B7-1) Purified (50 ug)
| Applications | FC |
| Reactivities | Canine, Mouse, Pig |
| Conjugation | Unconjugated |
Mouse Anti-Human CD80 (B7-1) Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD178 (CD95 Ligand) Purified (25 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-DQB1 Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-DQB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-39 amino acids from the N-terminal region of human HLA-DQB1. |
Active filters
Families
- Transmembrane
Pathways
- Type I diabetes mellitus
Filter by
Category
Target Symbol
- CD80 (103)
- CD86 (62)
- TNF (60)
- CD28 (37)
- IL12B (21)
- HLA-A (18)
- FASLG (13)
- HLA-DQA2 (13)
- HLA-G (7)
- HLA-DRB5 (6)
- HLA-B (4)
- HLA-DRA (4)
- LTA (4)
- HLA-DMB (3)
- HLA-DRB3 (3)
- HLA-E (3)
- PTPRN (3)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-F (2)
- HLA-C (1)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)