TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified
Applications | ELISA, FN |
Reactivities | Human |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Purified
Applications | FC |
Reactivities | Human |
CD28 mouse monoclonal antibody, clone B-T3, Purified
Applications | FC, IHC |
Reactivities | Human |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Azide Free
Applications | FC, FN |
Reactivities | Human |
HLA-DRA (C-term) rabbit polyclonal antibody
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 149-177 amino acids from the C-terminal region of human HLA-DRA. |
Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
HLA-DRB5 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 43~70 amino acids from the Central region of human HLA class II DRB5 beta / HLA-DRB5 |
IL12B mouse monoclonal antibody, clone 1-1A4, Purified
Applications | ELISA, IHC |
Reactivities | Human |
HLAG (HLA-G) mouse monoclonal antibody, clone MEM-G/1, Biotin
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Goat Polyclonal Antibody against IL12B / IL12p40
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGKSKREKKDRVFTD, from the internal region of the protein sequence according to NP_002178.2. |
Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA |
Goat Anti-CD28 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SQQLQVYSKTGFNCD, from the internal region of the protein sequence according to NP_006130.1. |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Mouse Anti-Human HLA-E Purified (25 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal HLA-G Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Rabbit Polyclonal Anti-HLA-A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Mouse Monoclonal Anti-CD80 Antibody [7A2]
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
purified CD80 Capture mouse monoclonal antibody, Luminex validated, clone OTI2E5
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700489 |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
Applications | ELISA |
Reactivities | Human |
Conjugation | HRP |
CD28 mouse monoclonal antibody, clone CD28.2, APC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | APC |
CD28 mouse monoclonal antibody, clone CD28.2, FITC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | FITC |
CD28 mouse monoclonal antibody, clone CD28.2, PE
Applications | FC |
Reactivities | Human, Primate |
Conjugation | PE |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
CD28 mouse monoclonal antibody, clone B-T3, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD28 mouse monoclonal antibody, clone B-T3, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Purified
Applications | FC |
Reactivities | Human |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
TNF alpha (TNF) mouse monoclonal antibody, clone B-C7, Azide Free
Applications | FN |
Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone B-D9, FITC
Applications | FC |
Conjugation | FITC |
TNF alpha (TNF) mouse monoclonal antibody, clone B-D9, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
IL12B rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLAB (HLA-B) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 184-212 amino acids from the Central region of human HLA-B |
HLA DMB (HLA-DMB) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 103-133 amino acids from the Central region of human HLA class II DM beta / HLA-DMB |
Rabbit polyclonal antibody to HLA-DRB1 (major histocompatibility complex, class II, DR beta 1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 56 and 250 of HLA-DRB1 (Uniprot ID#P01912) |
Rabbit polyclonal antibody to HLA-DRB3 (major histocompatibility complex, class II, DR beta 3)
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 4 and 266 of HLA-DRB3 (Uniprot ID#P79483) |
Rabbit polyclonal antibody to HLA-DRB4 (major histocompatibility complex, class II, DR beta 4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 266 of HLA DR beta (Uniprot ID#P13762) |
Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2. |
Mouse Anti-Human CD28 Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Hamster Anti-Mouse CD80 (B7-1) Purified (50 ug)
Applications | FC |
Reactivities | Canine, Mouse, Pig |
Conjugation | Unconjugated |
Mouse Anti-Human CD80 (B7-1) Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD178 (CD95 Ligand) Purified (25 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal HLA-DQB1 Antibody (N-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-DQB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-39 amino acids from the N-terminal region of human HLA-DQB1. |