Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Anti-NMDA NR2B Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Goat Polyclonal Anti-BDNF Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit anti-BDNF Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BDNF |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
Rabbit Polyclonal Anti-proBDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein. |
Rabbit Polyclonal Anti-TRPC1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular. |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-NDUFA4L2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit polyclonal anti-COX IV antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Mouse Monoclonal anti-NR2B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-SLC25A4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SLC25A4 |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BDNF antibody is: synthetic peptide directed towards the N-terminal region of Human BDNF. Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL |
Goat Polyclonal Anti-BAX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli. |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit Polyclonal NMDAR1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 |
Rabbit Polyclonal Anti-GRM5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5. |
USD 531.00
In Stock
Rabbit Monoclonal Antibody against GRM5 (Clone EPR2425Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-Bax antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Bax. |
Rabbit polyclonal anti-COX6C antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX6C. |
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-ATP5G3 antibody
Applications | IF, IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5G3. |
Rabbit polyclonal anti-NDUFA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4. |
Rabbit polyclonal anti-COX42 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX42. |
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913). |
Rabbit polyclonal SLC25A31 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SLC25A31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 139-167 amino acids from the Central region of human SLC25A31. |
Rabbit polyclonal SLC25A6 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SLC25A6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of human SLC25A6. |
Rabbit polyclonal NMDAR1 (Phospho-Ser890) antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR1 around the phosphorylation site of serine 890 (A-S-SP-F-K). |
Modifications | Phospho-specific |
Rabbit polyclonal COX41 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human COX41. |
Mouse Monoclonal anti-Bax Antibody
Applications | IP |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SLC25A6 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC25A6 antibody: synthetic peptide directed towards the N terminal of human SLC25A6. Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ |
Rabbit Polyclonal Anti-ATP5G2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP5G2 antibody: synthetic peptide directed towards the N terminal of human ATP5G2. Synthetic peptide located within the following region: SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA |
Rabbit Polyclonal Anti-Bax Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Rabbit Polyclonal Anti-COX42 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42 |
Rabbit Polyclonal Anti-COX6C Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C |
Rabbit Polyclonal Anti-COX IV antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX IV antibody: A synthesized peptide derived from human COX IV |
Rabbit Polyclonal Anti-Phospho-NMDAR1(Ser897) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-NMDAR1(Ser897) Antibody: A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Sersine 897 |
Modifications | Phospho-specific |
Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674) |
Rabbit Polyclonal antibody to COX4 (cytochrome c oxidase subunit IV isoform 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 169 of COX4 (Uniprot ID#P13073) |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal Bax (Thr167) antibody(Phospho-specific)
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T). |
Modifications | Phospho-specific |
Rabbit polyclonal GRIN2B(Ab-1303) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Rabbit polyclonal anti-SLC25A6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC25A6. |
Rabbit polyclonal anti-ATP5G2 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5G2. |
Rabbit polyclonal anti-NDUFA3 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA3. |