Germany
Japan
United Kingdom
China
BID Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BID |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR |
Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353) |
Rabbit Polyclonal Anti-ACTIN Antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal Caspase 8 (Tyr380) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 8 around the phosphorylation site of tyrosine 380 (Q-P-YP-L-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HLA-DOB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
Rabbit polyclonal anti-NOM1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOM1. |
Rabbit polyclonal CASP9 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9. |
Rabbit Polyclonal Caspase 8 (Ser347) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 around the phosphorylation site of Serine 347 |
| Modifications | Phospho-specific |
HLA-DRB3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRB3 |
Rabbit anti-CXADR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXADR |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA |
Rabbit Polyclonal Anti-EIF4G2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the N terminal of human EIF4G2. Synthetic peptide located within the following region: PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL |
Rabbit Polyclonal Anti-EIF4G3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4G3 antibody: synthetic peptide directed towards the N terminal of human EIF4G3. Synthetic peptide located within the following region: TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIA |
Rabbit Polyclonal Anti-EIF4G3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4G3 antibody: synthetic peptide directed towards the middle region of human EIF4G3. Synthetic peptide located within the following region: MRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRES |
Rabbit Polyclonal Anti-EIF4G1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4G1 antibody: synthetic peptide directed towards the middle region of human EIF4G1. Synthetic peptide located within the following region: PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ |
Rabbit Polyclonal Anti-Myh7 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Myh7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQ |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-MYH10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYH10 antibody: synthetic peptide directed towards the N terminal of human MYH10. Synthetic peptide located within the following region: WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD |
Rabbit Polyclonal Anti-Actin-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-Caveolin-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caveolin-1 Antibody: A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Anti-Caveolin 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caveolin 1 Antibody: A synthesized peptide derived from human Caveolin 1 |
Rabbit Polyclonal Anti-Beta actin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Beta actin antibody: A synthesized peptide derived from human Beta actin |
Rabbit anti Dystrophin Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the intra domain 410-450aa of human Dystrophin protein. This sequence is identical to mouse and Pan troglodytes and other species. |
USD 610.00
5 Days
smooth muscle Myosin heavy chain 11 (MYH11) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Mammalian |
| Immunogen | Bovine tracheal smooth muscle myosin. |
Rabbit Monoclonal Antibody against ITGB2 (Clone EP1286Y)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against FYN
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence VQCKDKEATKLTE, from the N Terminus of the protein sequence according to NP_002028.1; NP_694592.1; NP_694593.1. |
Rabbit Polyclonal antibody to CD55 (CD55 molecule, decay accelerating factor for complement (Cromer blood group))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 71 and 330 of CD55 (Uniprot ID#P08174) |
Rabbit Polyclonal antibody to DAP5 (eukaryotic translation initiation factor 4 gamma, 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 194 of DAP5 |
Rabbit Polyclonal antibody to Caspase 8 (caspase 8, apoptosis-related cysteine peptidase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 217 of Caspase 8 (Uniprot ID#Q14790) |
Rabbit polyclonal Shc (Tyr349) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine349 (H-Q-YP-Y-N) |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 3 (cleaved-Asp175) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Caspase 3. |
Rabbit polyclonal CASP3 (p17, Cleaved-Asp175) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Rabbit polyclonal Caspase 3 (Cleaved-Ser29) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP3. |
Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP8. |
Rabbit polyclonal ABL1 (Thr735) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ABL1 around the phosphorylation site of threonine 735 (S-V-TP-L-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CXADR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXADR. |
Active filters
Isotypes
- IgG
Pathways
- Viral myocarditis
Filter by
Category
Target Symbol
- CASP3 (20)
- ACTB (16)
- CASP9 (16)
- CASP8 (12)
- CAV1 (12)
- CCND1 (12)
- ABL1 (11)
- ICAM1 (11)
- SHC1 (10)
- FYN (9)
- CD40 (8)
- CYCS (8)
- EIF4G2 (7)
- BID (6)
- CD55 (6)
- ITGB2 (6)
- ACTG1 (4)
- CD40LG (4)
- CXADR (4)
- MYH11 (4)
- RAC1 (4)
- DMD (3)
- EIF4G1 (3)
- ITGAL (3)
- MYH7 (3)
- PRF1 (3)
- CD80 (2)
- CD86 (2)
- EIF4G3 (2)
- HLA-A (2)
- HLA-DMA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DQA2 (2)
- HLA-DRA (2)
- HLA-DRB3 (2)
- HLA-F (2)
- MYH1 (2)
- MYH9 (2)
- RAC2 (2)
- SGCA (2)
- SGCB (2)
- SGCG (2)
- SMURF2 (2)
- ABL2 (1)
- CD28 (1)
- DAG1 (1)
- HLA-B (1)
- HLA-DMB (1)
- HLA-DOA (1)
- HLA-DPB1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- HLA-G (1)
- LAMA2 (1)
- MYH10 (1)
- MYH13 (1)
- MYH14 (1)
- MYH4 (1)
- PARVG (1)
- SGCD (1)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Families
- Druggable Genome (186)
- Transmembrane (85)
- ES Cell Differentiation/IPS (52)
- Protease (48)
- Stem cell - Pluripotency (32)
- Transcription Factors (26)
- Protein Kinase (21)
- Secreted Protein (13)
- Stem cell relevant signaling - DSL/Notch pathway (12)
- Stem cell relevant signaling - JAK/STAT signaling pathway (12)
- Stem cell relevant signaling - Wnt Signaling pathway (12)
- Adult stem cells (2)