Germany
Japan
United Kingdom
China
Rabbit polyclonal ITGA5 (heavy chain, Cleaved-Phe42) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGA5. |
Antibodies
View as table Download
Rabbit polyclonal Integrin beta1 (Ab-789) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
Rabbit polyclonal PRKAG1/2/3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKAG1/2/3. |
Rabbit polyclonal Shc (Tyr349) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine349 (H-Q-YP-Y-N) |
| Modifications | Phospho-specific |
Rabbit polyclonal ITGA7 (light chain, Cleaved-Glu959) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Integrin alpha-7 light chain. |
Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGAV. |
Rabbit polyclonal anti-RyR2 (Ser2808) antibody (Phospho-specific)
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific phosphopeptide. The antibody against non-phosphopeptide was removed by chromatography using non-phosphopeptide corresponding to the phosphorylation site. |
| Modifications | Phospho-specific |
ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%). |
Rabbit polyclonal anti-Dystrophin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 3656 of human Dystrophin |
Anti-SHC1 (Phospho-Tyr427) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 427 (P-S-Y(p)-V-N derived from Human Shc1. |
| Modifications | Phospho-specific |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit Polyclonal Integrin alpha4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin alpha4 |
Rabbit Polyclonal Integrin beta3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 |
Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Lamin A/C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Lamin A/C |
Rabbit Polyclonal Lamin A/C (Ser392) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Lamin A/C around the phosphorylation site of Serine 392 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Shc Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Shc |
Rabbit Polyclonal Shc Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Shc |
Rabbit Polyclonal Shc (Tyr349) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Shc around the phosphorylation site of Tyrosine 349 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Shc (Tyr427) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Shc around the phosphorylation site of Tyrosine 427 |
| Modifications | Phospho-specific |
Rabbit Polyclonal TNNI3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 |
Rabbit Polyclonal TNNI3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 |
Rabbit Polyclonal TNNI3 (Ser43) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 around the phosphorylation site of Serine 43 |
| Modifications | Phospho-specific |
Rabbit Polyclonal TNNI3 (Thr142) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 around the phosphorylation site of Threonine 142 |
| Modifications | Phospho-specific |
Rabbit Polyclonal AMPK1 (Ser485) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 around the phosphorylation site of Serine 485 |
| Modifications | Phospho-specific |
Rabbit Polyclonal AMPK β1(Ser181) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK β1 around the phosphorylation site of Serine 181 |
| Modifications | Phospho-specific |
Rabbit polyclonal PRKAB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PRKAB1. |
Rabbit Polyclonal AMPK1 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 |
Rabbit Polyclonal AMPK alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha |
Rabbit Polyclonal AMPK β1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK β1 |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Anti-ITGA2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
Rabbit anti IGF-I Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Integrin alpha V Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Cardiac Troponin I (TNNI3) (27-40) goat polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Human Cardiac Troponin I (27-40) |
Lamin A (LMNA) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Lamin A/C |
Rabbit Polyclonal antibody to AMPK gamma 2 (protein kinase, AMP-activated, gamma 2 non-catalytic subunit)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 386 and 569 of AMPK gamma 2 (Uniprot ID#Q9UGJ0) |
Rabbit polyclonal antibody to CACNG5 (calcium channel, voltage-dependent, gamma subunit 5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 43 and 246 of CACNG5 (Uniprot ID#Q9UF02) |
Rabbit polyclonal ITGB1 (Tyr795) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITGB1 around the phosphorylation site of tyrosine 795 (P-K-YP-E-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta3 (Ab-785) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Rabbit polyclonal anti-CACNG1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Rabbit polyclonal ITGB4 (Tyr1510) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CACNA2D4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4. |
Active filters
Isotypes
- IgG
Pathways
- Hypertrophic cardiomyopathy (HCM)
Filter by
Category
Target Symbol
- ACTB (16)
- CACNB2 (15)
- PRKAA1 (12)
- ITGB3 (11)
- LMNA (10)
- SHC1 (10)
- TNF (10)
- TNNI3 (9)
- DES (8)
- IGF1 (8)
- ITGAV (8)
- TGFB1 (8)
- TPM2 (8)
- TGFB2 (7)
- CACNB1 (6)
- ITGA4 (6)
- ITGB1 (6)
- PRKAB1 (6)
- IL6 (5)
- ITGA6 (5)
- ITGB4 (5)
- PRKAA2 (5)
- TPM1 (5)
- ACE (4)
- ACTG1 (4)
- CACNB4 (4)
- CACNG1 (4)
- ITGA5 (4)
- ITGB5 (4)
- PRKAG1 (4)
- CACNA2D4 (3)
- CACNB3 (3)
- CACNG6 (3)
- DMD (3)
- EMD (3)
- ITGA2B (3)
- ITGA7 (3)
- MYH7 (3)
- MYL3 (3)
- PRKAG2 (3)
- ACTC1 (2)
- CACNA1C (2)
- CACNA2D1 (2)
- CACNA2D2 (2)
- CACNG4 (2)
- ITGA2 (2)
- ITGA3 (2)
- MYL2 (2)
- SGCA (2)
- SGCB (2)
- SGCG (2)
- TGFB3 (2)
- TNNC1 (2)
- TPM3 (2)
- TPM4 (2)
- ATP2A2 (1)
- CACNA1D (1)
- CACNA1S (1)
- CACNA2D3 (1)
- CACNG3 (1)
- CACNG5 (1)
- CACNG7 (1)
- DAG1 (1)
- ITGA11 (1)
- ITGA8 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- MYBPC3 (1)
- PARVG (1)
- PRKAB2 (1)
- PRKAG3 (1)
- RYR2 (1)
- SGCD (1)
- SLC8A1 (1)
- TNNT2 (1)
Reactivities
- Human (277)
- Mouse (198)
- Rat (159)
- Bovine (12)
- Chicken (11)
- Dog (11)
- Pig (6)
- Rabbit (6)
- Cow (5)
- Monkey (5)
- Drosophila (4)
- X. tropicalis (4)
- Canine (3)
- Zebrafish (3)
- Chimpanzee (2)
- Feline (2)
- Invertebrate (2)
- Xenopus (2)
- All Species (1)
- Bat (1)
- Gorilla (1)
- Guinea Pig (1)
- Hamster (1)
- Horse (1)
- Primate (1)
- Rhesus Monkey (1)
- Sheep (1)