Antibodies

View as table Download

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

Rabbit Polyclonal Anti-TUBE1 Antibody - middle region

Applications IHC, WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Rabbit polyclonal ATP6V1B1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1.

Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)

Applications IF, IHC, WB
Reactivities Human, Mouse, Drosophila, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A

Rabbit polyclonal FOXG1 Antibody (Center)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1.

Mouse monoclonal Hsp70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, C.elegans, Canine, Chicken, Drosophilia, Carp, Guinea pig, Hamster, Monkey, Pig, Rabbit, Sheep
Conjugation Unconjugated

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

Rabbit Polyclonal Cdc73 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cdc73 antibody: drosophila Cdc73 (Cell division cycle protein 73), using the full length recombinant protein.

Rabbit Polyclonal H3K9me3 Antibody

Applications WB
Reactivities Drosophila, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9me3 antibody: the region of histone H3 containing the trimethylated lysine 9 (H3K9me3).

Rabbit Polyclonal Rtf1 Antibody

Applications WB
Reactivities Drosophila
Conjugation Unconjugated
Immunogen The immunogen for anti-Rtf1 antibody: drosophila Rtf1 (Rtf1, Paf1/RNA polymerase II complex component, homolog), using the full length recombinant protein.

Rabbit polyclonal Hsp 90 alpha antibody

Applications WB
Reactivities Chicken, Drosophila, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 289-300 of human Hsp90 protein.

Mouse Monoclonal anti-HSPA1A Antibody

Applications FC
Reactivities Human, Mouse, Rat, Bovine, dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated

Rabbit polyclonal anti-CASZ1 antibody

Applications WB
Reactivities Human, Mouse, Drosophila, Chimpanzee and Macaque
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human Casz1 protein.

Rabbit anti TK1 (Thymidine Kinase) Polyclonal Antibody

Applications WB
Reactivities Drosph
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of fruit fly thymidine kinase protein.

Rabbit Polyclonal Anti-beta-Actin Antibody (biotin)

Applications WB
Reactivities Chicken, Drosophila, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Biotin-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin.

Rabbit Polyclonal Anti-beta-Actin Antibody (HRP)

Applications WB
Reactivities Chicken, Drosophila, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen HRP-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin.

Mouse Monoclonal Anti-beta-Actin Antibody [10B7]

Applications WB
Reactivities Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish
Conjugation Unconjugated

Mouse Monoclonal Anti-beta-Actin Antibody [10B7] (biotin)

Applications WB
Reactivities Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish
Conjugation Unconjugated

Anti-AKT (Thr342) Antibody

Applications WB
Reactivities Drosophila
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr342 of Drosophila AKT, conjugated to keyhole limpet hemocyanin (KLH)

Anti-p70 S6 Kinase (Ser398) Antibody

Applications WB
Reactivities Drosophila
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr398 of Drosophila p70 S6K protein, conjugated to keyhole limpet hemocyanin (KLH).