Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
OLFM4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | OLFM4 / Olfactomedin 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset (100%); Guinea pig (94%); Orangutan, Rat, Hamster, Dog, Rabbit (88%); Galago, Mouse, Panda, Horse (81%). |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
GluT-1 / GLAST Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC1A3 / GluT-1 / GLAST antibody was raised against synthetic 19 amino acid peptide from cytoplasmic domain of human SLC1A3 / GLAST. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Rabbit, Pig (100%); Panda, Dog, Opossum, Guinea pig, Turkey, Chicken (95%); Xenopus (84%). |
Rabbit polyclonal antibody to RAMP1 (receptor (G protein-coupled) activity modifying protein 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 84 and 148 of RAMP1 (Uniprot ID#O60894) |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
TM9SF3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Guinea Pig, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | TM9SF3 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus (100%); Lizard, Stickleback, Medaka (93%); Bat, Salmon, Zebrafish, Eye worm, Tick (87%); Pufferfish, Drosophila, Water flea, Nematode (80%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Guinea Pig, Human, Rat, Dog, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Rabbit anti Actin, skeletal muscle Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Rabbit, GP |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human alpha skeletal muscle isoforms of actin. This sequence is identical in human, rat, mouse, dog, bovine, guinea pig, sheep and frog origins. |
Goat Polyclonal Antibody against PCK2 / PEPCK-M
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2. |
Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1) |
Mouse Monoclonal anti-HSPA1A Antibody
| Applications | FC |
| Reactivities | Human, Mouse, Rat, Bovine, dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Galago, Elephant, Platypus, Medaka (94%); Opossum, Turkey, Zebra finch, Chicken, Stickleback, Pufferfish (89%); Xenopus, Zebrafish (83%). |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Guinea pig, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 19 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (100%); Hamster (95%); Stickleback, Medaka, Pufferfish, Zebrafish (84%). |
SLC4A2 / AE2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Dog, Hamster, Horse, Human, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC4A2 / AE2 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SLC4A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Rabbit, Pig (100%); Monkey, Bovine, Guinea pig (94%); Elephant (89%); Bat, Opossum (83%). |
Histamine 3 Receptor / HRH3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HRH3 / Histamine 3 Receptor antibody was raised against synthetic 16 amino acid peptide from 2nd cytoplasmic domain of human HRH3 / Histamine H3 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Guinea pig (100%); Panda, Bat, Dog (94%); Opossum (81%). |
CCKAR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | CCKAR / CCK1R antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CCKAR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Rabbit, Guinea pig (94%); Mouse, Elephant, Panda, Bat (88%); Rat, Dog, Horse, Opossum (81%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
Rabbit polyclonal Glutathione Peroxidase 4 antibody
| Applications | WB |
| Reactivities | Guinea Pig, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse GPx4 protein. |
Active filters
Reactivities
- Guinea Pig
Isotypes
- IgG
Filter by
Category
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Families
Pathways
- Neuroactive ligand-receptor interaction (6)
- Calcium signaling pathway (3)
- Metabolic pathways (3)
- Vascular smooth muscle contraction (3)
- Adipocytokine signaling pathway (2)
- Antigen processing and presentation (2)
- Cell adhesion molecules (CAMs) (2)
- Endocytosis (2)
- Focal adhesion (2)
- MAPK signaling pathway (2)
- Pathways in cancer (2)
- Prion diseases (2)
- Regulation of actin cytoskeleton (2)
- Spliceosome (2)
- Adherens junction (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Basal cell carcinoma (1)
- Bladder cancer (1)
- Citrate cycle (TCA cycle) (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Glycolysis / Gluconeogenesis (1)
- Hedgehog signaling pathway (1)
- Histidine metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Insulin signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Melanogenesis (1)
- PPAR signaling pathway (1)
- Pancreatic cancer (1)
- Pathogenic Escherichia coli infection (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Pyruvate metabolism (1)
- Renal cell carcinoma (1)
- Tight junction (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- VEGF signaling pathway (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)
- mTOR signaling pathway (1)