Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal PDK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 |
Rabbit Polyclonal PDK1 (Ser241) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 around the phosphorylation site of Serine 241 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPAR-gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-gamma |
Goat Polyclonal Antibody against NR1H3; NR1H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRLQDKKLPPLLSEI, from the internal region of the protein sequence according to NP_005684; NP_009052. |
Rabbit polyclonal ILK (Ab-246) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ILK around the phosphorylation site of serine 246 (I-F-SP-H-P). |
Rabbit polyclonal anti-FATP4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 598 of rat FATP4 |
Rabbit polyclonal anti-Angptl4 (FIAF) antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 84 of mouse FIAF |
Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 206 of rat SCD |
Rabbit polyclonal anti-lipoprotein lipase (LPL) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 427 of rat PLP. |
Rabbit Polyclonal ACSL1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal ACSL1 antibody was raised against an 18 amino acid peptide near the center of human ACSL1. The immunogen is located within amino acids 240 - 290 of ACSL1. |
Rabbit polyclonal SORBS1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This SORBS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 866-892 amino acids from the Central region of human SORBS1. |
Rabbit Polyclonal Phospho-PPAR- gamma (Ser112) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR- gamma around the phosphorylation site of Serine 112 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI |
USD 1,140.00
9 Weeks
Goat Polyclonal Antibody against PCK2 / PEPCK-M
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2. |
Goat Polyclonal Antibody against PPAR delta (Isoform 1)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CHPLLQEIYKDMY, from the C Terminus of the protein sequence according to NP_006229.1. |
Goat Polyclonal Antibody against RXR beta
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRDGMGDSGRDSRSP, from the internal region of the protein sequence according to NP_068811. |
Goat Polyclonal Antibody against RXR gamma
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RQRSRERAESEAEC, from the internal region of the protein sequence according to NP_008848. |
Goat Polyclonal Antibody against SORBS1
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1. |
Goat Polyclonal Antibody against ACOX2 (Near C-terminal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQSRLRPSDPEAK, from the internal region (near the C Terminus) of the protein sequence according to NP_003491.1. |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Rabbit polyclonal antibody to Retinoid X Receptor beta (retinoid X receptor, beta)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 20 and 113 of Retinoid X Receptor beta (Uniprot ID#P28702) |
Goat Anti-CPT2 (aa141-154) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PKSEYNDQLTRATN, from the internal region of the protein sequence according to NP_000089.1. |
Goat Anti-FACL4 / ACSL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HYLKDIERMYGGK, from the C Terminus of the protein sequence according to NP_004449.1; NP_075266.1. |
Rabbit polyclonal anti-ACSL6 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACSL6. |
Rabbit polyclonal anti-ACADL antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 38 of human ACADL |
Rabbit polyclonal anti-PEPCK-C antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surroundign amino acid 507 of mouse PEPCK-C |
Anti-NR1H3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-330 amino acids of human nuclear receptor subfamily 1, group H, member 3 |
Mouse monoclonal FAPB3 Antibody(Ascites)
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-ILK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ILK antibody is: synthetic peptide directed towards the C-terminal region of Human ILK. Synthetic peptide located within the following region: MKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD |
Rabbit Polyclonal Anti-RXRB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: GDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPP |
Rabbit anti-ACSL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACSL5 |
Rabbit Polyclonal Anti-ACOX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT |
Rabbit Polyclonal Anti-NR1H3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3. Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Pathways
- PPAR signaling pathway
Filter by
Category
Target Symbol
- LPL (61)
- PPARA (37)
- SCP2 (21)
- ACADM (16)
- NR1H3 (15)
- PPARD (13)
- CPT1B (11)
- ILK (10)
- PPARG (9)
- ACSL5 (6)
- ACAA1 (5)
- ADIPOQ (5)
- ANGPTL4 (5)
- APOA5 (5)
- FABP2 (5)
- PCK1 (5)
- PDPK1 (5)
- PLIN1 (5)
- FABP4 (4)
- ACOX2 (3)
- ACOX3 (3)
- APOA1 (3)
- CPT1A (3)
- CPT2 (3)
- GK (3)
- ME1 (3)
- OLR1 (3)
- PLTP (3)
- RXRB (3)
- RXRG (3)
- ACOX1 (2)
- ACSL1 (2)
- ACSL4 (2)
- CYP4A11 (2)
- FABP1 (2)
- FABP3 (2)
- FABP7 (2)
- MMP1 (2)
- PCK2 (2)
- SCD (2)
- SLC27A1 (2)
- SLC27A4 (2)
- SORBS1 (2)
- UCP1 (2)
- ACADL (1)
- ACSL6 (1)
- CD36 (1)
- CPT1C (1)
- CYP27A1 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- EHHADH (1)
- FABP6 (1)
- GK2 (1)
- RXRA (1)
- SLC27A2 (1)
- SLC27A5 (1)
- SLC27A6 (1)