Rabbit Polyclonal H3K4me3 Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K79me2 Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K79me2 antibody: histone H3 containing the dimethylated lysine 79 (H3K79me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3R17me2 Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3R17me2 antibody: histone H3 containing the asymmetrically dimethylated arginine 17 (H3R17me2(asym)), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3 pan Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3 pan antibody: histone H3, using two KLH-conjugated synthetic peptides containing an unmodified sequence from the central part and from the C-terminus of the protein. |
Rabbit Polyclonal H3K27me3S28p Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3S28p antibody: against histone H3, trimethylated at lysine 27 and phosphorylated at serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K64me3 Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K64me3 antibody: histone H3 containing the trimethylated lysine 64 (H3K64me3), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K20me1 Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K20me1 antibody: histone H4 containing the monomethylated lysine 20 (H4K20me1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K20me1 Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K20me1 antibody: histone H4 containing the monomethylated lysine 20 (H4K20me1), using a KLH-conjugated synthetic peptide. |
MonoMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
MonoMethyl-Histone H3-K9 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3 |
TriMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic tri-methylated peptide corresponding to residues surrounding K36 of human histone H3 |
MonoMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal H3K56ac Antibody
| Applications | Dot, ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K56ac antibody: the region of histone H3 containing the acetylated lysine 56 (H3K56ac), using a KLH-conjugated synthetic peptide. |
USD 320.00
2 Weeks
Complement C5 (C5) (neoepitope) mouse monoclonal antibody, clone HCC5b.1 (neo), Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Goat, Human, Porcine, Primate |
Rabbit Polyclonal Anti-C4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM |
Rabbit Polyclonal H2A.XS139p Antibody
| Applications | Dot, ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H2A.XS139p antibody: the region of histone H2A.X containing the phosphorylated serine 139 (H2A.XS139p), using a KLH-conjugated synthetic peptide. |
USD 745.00
5 Days
Complement C4A (C4A) (neoepitope) mouse monoclonal antibody, clone 057-51.5.1.6, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
Mouse monoclonal H2AFX Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Symmetric DiMethyl-Histone H3-R2 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R2 of human histone H3 |
MonoMethyl-Histone H3-R17 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic mono-methylated peptide peptide corresponding to residues surrounding Arg17of human histone H3 |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal H2B pan Antibody
| Applications | Dot, ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H2B pan antibody: histone H2B using a KLH-conjugated synthetic peptide containing an unmodified sequence from the C-terminal part of the protein. |
Rabbit Polyclonal H2A pan Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H2A pan antibody: histone H2A using 2 KLH-conjugated synthetic peptides containing a sequence from the central and the C-terminal part of the protein. |
Rabbit Polyclonal H4 pan Antibody
| Applications | Dot, ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4 pan antibody: histone H4 using a KLH-conjugated synthetic peptide containing an unmodified sequence from the central part of the protein. |
USD 379.00
In Stock
TRIM21 human polyclonal antibody, Purified
| Applications | ELISA, ID |
| Reactivities | Human |
Germany
Japan
United Kingdom
China
