Germany
Japan
United Kingdom
China
Antibodies
Download
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Phospho-NOS3-S1177 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S1177 of human NOS3 |
| Modifications | Phospho-specific |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Antibody against MAP3K5 (S83)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASK1(MEKK5/MAP3K5) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 61-90 amino acids from human ASK1(MEKK5/MAP3K5). |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal ASK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ASK1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ASK1. |
Rabbit Polyclonal GluR1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR1 |
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
USD 370.00
2 Weeks
Glutamate receptor ionotropic, NMDA 2D (GRIN2D) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit anti-NOS2A polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human NOS2A. |
Active filters
Pathways
- Amyotrophic lateral sclerosis (ALS)
Filter by
Target Symbol
- TP53 (255)
- MAP2K3 (158)
- BCL2 (99)
- MAPK13 (99)
- NEFL (78)
- BID (60)
- TNF (60)
- PRPH (53)
- CASP3 (49)
- MAPK14 (41)
- BAX (35)
- BCL2L1 (29)
- NEFM (29)
- CHP1 (28)
- NEFH (27)
- NOS2 (27)
- CASP9 (26)
- NOS3 (25)
- CAT (23)
- BAD (21)
- MAP3K5 (20)
- GRIN1 (19)
- GRIN2B (18)
- RAB5A (18)
- CASP1 (17)
- CYCS (17)
- TOMM40L (17)
- GRIA1 (15)
- PPP3CA (14)
- SOD1 (14)
- TNFRSF1A (13)
- APAF1 (12)
- GRIA2 (12)
- TNFRSF1B (12)
- MAP2K6 (10)
- MAPK12 (9)
- NOS1 (9)
- PPP3CB (9)
- GRIN2A (8)
- MAPK11 (7)
- TOMM40 (7)
- RAC1 (6)
- ALS2 (5)
- CCS (5)
- DAXX (5)
- GPX1 (4)
- GRIN2C (4)
- GRIN2D (3)
- PPP3CC (3)
- SLC1A2 (3)
- CASPASE 9 (2)
- DERL1 (2)
- CHP2 (1)
- PPP3R1 (1)
- PPP3R2 (1)
Reactivities
- Human (1364)
- Mouse (849)
- Rat (830)
- Monkey (219)
- Dog (168)
- Canine (17)
- Bovine (16)
- Rabbit (9)
- Chicken (8)
- Feline (8)
- Pig (8)
- Mammalian (7)
- Avian (5)
- Hamster (5)
- Porcine (5)
- Cow (3)
- Gerbil (3)
- Sheep (3)
- Xenopus (3)
- Drosophila (2)
- Primate (2)
- X. tropicalis (2)
- Zebrafish (2)
- C. elegans (1)
- Coral (1)
- Equine (1)
- Fish (1)
- Guinea Pig (1)
- Yeast (1)