Antibodies

View as table Download

Rabbit Polyclonal Anti-DTX4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DTX4 antibody was raised against a 19 amino acid peptide near the center of human DTX4.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human ATG4B.

Rabbit polyclonal anti-ATG4B antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATG4B.

Rabbit Polyclonal Anti-ATG4B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4B antibody: synthetic peptide directed towards the N terminal of human ATG4B. Synthetic peptide located within the following region: WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS

Rabbit Polyclonal Anti-ATG4B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4B Antibody: A synthesized peptide derived from human ATG4B

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL

Rabbit Polyclonal ATG4B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 350-400 of human APG4B was used as the immunogen.

Rabbit polyclonal anti-ATG4B antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATG4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-290 amino acids from the Central region of human ATG4B.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG4B Antibody: synthetic peptide directed towards the C terminal of human ATG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL

Carrier-free (BSA/glycerol-free) ATG4B mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-APG4B Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 5-20 amino acids of Human Autophagy-related protein 4 homolog B

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATG4B

ATG4B mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATG4B mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated