Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli.

Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)

Applications IHC, IP, WB
Reactivities Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep
Conjugation Unconjugated

Rabbit polyclonal HIF1A Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Hamster
Conjugation Unconjugated
Immunogen This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A.

Rabbit Polyclonal HIF1A antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HIF1A

USD 320.00

In Stock

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 470 to 590 aa of human HIF1a produced in E. coli.

HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen A peptide mapping at the N-terminus of HIF-1α of Human origin, different from the related Rat and Mouse sequences by two sequences.

HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal HIF-1 alpha Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate
Conjugation Unconjugated
Immunogen A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221]

Rabbit polyclonal Hif-1 alpha hydroxy P564 antibody

Applications WB
Reactivities Bovine, Human, Monkey, Mouse, Rat, Xenopus, Dog
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region surrounding the P564 of human HIF-1a.

Rabbit Polyclonal HIF-1 alpha Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus
Conjugation Unconjugated
Immunogen Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665]

Rabbit polyclonal HMGN phospho S20/S24 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-28 of human HMGN protein (see below).

Rabbit Polyclonal anti-HIF1A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the N terminal of human HIF1A. Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS

Rabbit Polyclonal Anti-HIF1A Antibody

Applications WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA

Rabbit Polyclonal HIF-1 alpha Antibody

Applications WB
Reactivities Human, Mouse, Porcine
Conjugation Unconjugated
Immunogen Genomic sequence made to an internal portion of human HIF-1 alpha (within residues 400-550). [Swiss-Prot# Q16665]

Rabbit Polyclonal HIF-1 alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen Fusion protein containing amino acids 432-528 of human HIF-1 alpha [UniProt# Q16665]

Rabbit Polyclonal HIF-1 alpha [Exon 9] Antibody (exon 9)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 350-400). [Swiss-Prot# Q16665]

Rabbit Polyclonal HIF-1 alpha [Exon 10] Antibody (exon 10)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 400-450). [Swiss-Prot# Q16665]

Rabbit Polyclonal HIF-1 alpha [Exon 12] Antibody (exon 12)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 550-600). [Swiss-Prot# Q16665]

Rabbit Polyclonal HIF-1 alpha [Exon 13] Antibody (exon 13)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 700-750). [Swiss-Prot# Q16665]

Rabbit anti HIF, alpha Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A twenty-one amino acids synthetic peptide corresponding to the internal sequence of HIF alpha protein. This sequence is identical to human, rat and mouse origins.

Carrier-free (BSA/glycerol-free) HIF1A mouse monoclonal antibody,clone OTI2D5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-HIF1A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HIF1A

HIF1A mouse monoclonal antibody,clone OTI2D5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated