Antibodies

View as table Download

Rabbit Polyclonal Anti-Aqp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV

Rabbit Polyclonal Aquaporin-2 Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Porcine, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminus portion of the rat protein (within residues 200-300). [Swiss-Prot# P34080]

Rabbit Polyclonal AQP2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AQP2 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human AQP2.

Rabbit Anti-Aquaporin 2 (Ser261) Antibody (Phospho-Specific)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser261 conjugated to KLH
Modifications Phospho-specific

Rabbit Anti-Aquaporin 2 (Ser264) Antibody (Phospho-Specific)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser264 conjugated to KLH
Modifications Phospho-specific

Rabbit Anti-Aquaporin 2 (Ser 269) Antibody (Phospho-Specific)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser269 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal Anti-Aquaporin 2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat. Not yet tested on other species
Conjugation Unconjugated
Immunogen C-terminal peptide

Rabbit polyclonal Anti-Aquaporin 2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RQSVELHSPQSLPRGSKA, corresponding to amino acid? residues 254-271 of rat AQP2.? Intracellular, C-terminus.

Anti-AQP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-271 amino acids of Human Aquaporin-2

Anti-AQP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-271 amino acids of Human Aquaporin-2

AQP2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 147-271 of human AQP2 (NP_000477.1).
Modifications Unmodified