Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Antibodies
View as table DownloadRabbit anti-E2F6 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human E2F6 |
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F6 Antibody: A synthesized peptide derived from human E2F6 |
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F6 antibody: synthetic peptide directed towards the middle region of human E2F6. Synthetic peptide located within the following region: HEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTS |
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F6 antibody: synthetic peptide directed towards the middle region of human E2F6. Synthetic peptide located within the following region: HEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTS |
Goat Anti-E2F6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NPQQSEELLEVSN, from the C Terminus of the protein sequence according to NP_937987.2. |
Rabbit Polyclonal Anti-E2F6 Antibody
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2f6 antibody is: synthetic peptide directed towards the middle region of Rat E2f6. Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL |
E2F6 Rabbit polyclonal Antibody
| Applications | ChIP, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-281 of human E2F6 (NP_937987.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- E2F6