Rabbit Polyclonal Anti-PDYN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pdyn antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLTVSGLRGKDDLEDEVALEEGYSALAKLLEPVLKELEKSRLLTSVPEEK |
Rabbit Polyclonal Anti-PDYN Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDYN antibody: synthetic peptide directed towards the middle region of human PDYN. Synthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE |
Rabbit polyclonal anti Dynorphin A; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-Trp-Asp-Asn-Gln-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin A (1-13); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin B; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin A (3-14), neat antiserum
| Applications | ELISA |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp- OH coupled to carrier protein. |
Guinea pig polyclonal anti Dynorphin B; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-OH coupled to carrier protein. |
Guinea pig polyclonal anti Dynorphin B; diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-OH coupled to carrier protein. |
ProDynorphin (PDYN) (1-13) rabbit polyclonal antibody, Serum
| Applications | IHC, R |
| Reactivities | Guinea Pig, Hamster, Human, Monkey, Porcine, Rat |
| Immunogen | Synthetic peptide, YGGFLRRQFKVVT, corresponding to full-length porcine dynorphin B (1-13), conjugated to thyroglobulin. |
Rabbit polyclonal anti Dynorphin A; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin A (1-8); diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
Rabbit polyclonal anti Dynorphin A; diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin A (1-8); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin A (1-13); diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin B; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin A (1-13); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu- Lys-OH coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin A (1-10) amide; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Dynorphin A (1-10) amide; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Leumorphin (hu); neat antiserum
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val- Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala- OH coupled to carrier protein. |
Rabbit polyclonal anti a-Neoendorphin; diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys-OH coupled to carrier protein. |
Rabbit polyclonal anti a-Neoendorphin; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys-OH coupled to carrier protein. |
Rabbit polyclonal anti a-Neoendorphin; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys-OH coupled to carrier protein. |
PDYN Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-254 of human PDYN (NP_077722.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
